Recombinant Mouse Orexin receptor type 2 (Hcrtr2)

Shipped with Ice Packs
In Stock

Description

Functional Roles

HCRTR2 mediates orexin signaling to regulate:

  • Wakefulness: Essential for maintaining long wakefulness bouts; its absence mimics narcolepsy .

  • Feeding Behavior: Modulates appetite and energy balance.

  • Stress and Reward: Influences drug-seeking behaviors and stress responses .

Key Research Findings:

  • Restoration of HCRTR2 in the tuberomammillary nucleus (TMN) of mice rescues sleepiness but not fragmented sleep, highlighting its role in arousal circuits .

  • Dual OX2R antagonists (e.g., suvorexant) suppress wakefulness by blocking orexin signaling .

Ligands and Pharmacological Modulators

HCRTR2 binds orexin A and B with high affinity, though orexin B shows 5–10-fold selectivity over OX1R . Selective agonists and antagonists are critical for studying receptor-specific pathways.

Ligand TypeExamplesFunction
AgonistsOrexin A/B, Danavorexton, FirazorextonPromote wakefulness, feeding
AntagonistsSuvorexant, Lemborexant, JNJ-10397049Induce sleep, treat insomnia

Selectivity Data:

  • Orexin B: 5–10-fold preference for OX2R over OX1R .

  • Suvorexant: Dual OX1R/OX2R antagonist with IC50 values <10 nM .

Research Applications

Recombinant HCRTR2 is utilized in:

  • Structural Studies: Crystallization with ligands to map binding pockets .

  • Functional Assays: Measuring calcium mobilization or G-protein signaling in response to orexins .

  • Drug Discovery: Screening antagonists for insomnia therapies .

Experimental Tools:

  • Antibodies: PE-conjugated antibodies for flow cytometry (e.g., R&D Systems #IC5246P) .

  • Recombinant Proteins: HEK293-expressed HCRTR2 for ligand-binding assays (Creative BioMart) .

Associated Diseases and Pathways

HCRTR2 dysregulation is implicated in:

DiseaseMechanismReferences
NarcolepsyLoss of orexin/HCRTR2 signaling
ObesityOX2R signaling resistance to diet-induced obesity
InsomniaTarget for dual OX1R/OX2R antagonists

Pathways Involving HCRTR2:

  • Neuroactive Ligand-Receptor Interaction: Modulates arousal via orexin signaling .

  • GPCR Downstream Signaling: Couples to Gαq/11 proteins, increasing intracellular calcium .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific requirement for the format, please indicate your preference when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this to us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Hcrtr2; Mox2r; Orexin receptor type 2; Ox-2-R; Ox2-R; Ox2R; Hypocretin receptor type 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-460
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MSSTKLEDSLSRRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAG YIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETW FFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVVIWIVS CIIMIPQAIVMECSSMLPGLANKTTLFTVCDEHWGGEVYPKMYHICFFLVTYMAPLCLMI LAYLQIFRKLWCRQIPGTSSVVQRKWKQQQPVSQPRGSGQQSKARISAVAAEIKQIRARR KTARMLMVVLLVFAICYLPISILNVLKRVFGMFTHTEDRETVYAWFTFSHWLVYANSAAN PIIYNFLSGKFREEFKAAFSCCLGVHHRQGDRLARGRTSTESRKSLTTQISNFDNVSKLS EHVVLTSISTLPAANGAGPLQNWYLQQGVPSSLLSTWLEV
Uniprot No.

Target Background

Function
This protein is a nonselective, high-affinity receptor for both orexin-A and orexin-B neuropeptides. It triggers an increase in cytoplasmic Ca(2+) levels upon binding to orexin-A.
Gene References Into Functions
  1. In a heart failure model, HCRTR2-deficient mice exhibited poorer cardiac function, worse treadmill exercise capacity, and greater myocardial scarring. PMID: 26653627
  2. Orexin activation of OX2R in the brain centrally enhances bone formation by reducing circulating leptin levels. PMID: 24794976
  3. Knocking down Orx2 receptors in the basolateral amygdala increased anxious behavior as measured by reduced social preference and decreased time spent in the center of an open field. PMID: 24485472
  4. OX2R activation induces PKC-mediated ERK and CREB phosphorylation. PMID: 22652455
  5. In the hypothalamus, OX2 receptors play an inhibitory role in regulating basal concentrations of NE, ACh, and Hist. In the prefrontal cortex, the evoked release of monoamines NE, 5-HT, and DA appears to be negatively controlled by OX2 receptors. PMID: 22038504
  6. Mice lacking OX2R signaling exhibited poor maintenance of wakefulness, indicating sleepiness and fragmented sleep, and lacked any electrophysiological response to orexin-A in the wake-promoting neurons of the tuberomammillary nucleus. PMID: 21368172
  7. Activation of orexin neurons through OX2R might play a significant role in maintaining arousal. PMID: 20861370
  8. Regulation of sleep/wake states is entirely achieved by OX(2)R-expressing neurons without involving H(1)R-mediated pathways. Maintenance of basal physiological sleep/wake states is fully achieved without both H(1) and OX(1) receptors. PMID: 19694625
  9. The SAF diet can alter adipocytic adiposity-related gene expression and effectively ameliorate diet-induced obesity. PMID: 20213045
  10. Hypocretin receptor 2 mRNA levels decreased with age in the hippocampus, thalamus, pons, and medulla. PMID: 12399012
  11. OX2alphaR is expressed in various regions of the mouse brain and has low expression in the caudal part of the cerebellum. PMID: 16806113
  12. Enhanced orexin-orexin receptor 2 signaling confers resistance to diet-induced features of the metabolic syndrome through negative energy homeostasis and improved leptin sensitivity. PMID: 19117547
  13. Biochemical and behavioral characterization of EMPA, a novel high-affinity, selective antagonist for the OX(2) receptor. PMID: 19751316

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed. Isoform 2 not detected in skeletal muscle and kidney.

Q&A

What is Mouse Orexin Receptor Type 2 (Hcrtr2) and what are its structural characteristics?

Mouse Orexin Receptor Type 2 (Hcrtr2) is a 40 kDa 7-transmembrane G-protein-coupled glycoprotein that functions as a high-affinity receptor for both orexin-A and orexin-B neuropeptides (also known as hypocretins 1 and 2) . The receptor belongs to the G-protein coupled receptor (GPCR) family and possesses the characteristic seven-transmembrane domain structure typical of this receptor class . The full amino acid sequence consists of 444 amino acids in humans, with high conservation across species .

When expressing recombinant mouse Hcrtr2, researchers should note that the protein requires proper post-translational modifications, particularly glycosylation, for optimal functionality. The receptor's three-dimensional structure includes extracellular domains that interact with orexin peptides, transmembrane regions that anchor the receptor to the cell membrane, and intracellular domains that couple with G-proteins to initiate downstream signaling cascades.

How does Mouse Hcrtr2 compare with human HCRTR2 in terms of sequence homology and functional conservation?

Mouse Hcrtr2 shares significant sequence homology with human HCRTR2, particularly in the extracellular regions that are critical for ligand binding. Specifically, the extracellular portions of human HCRTR2 share 92% amino acid identity with corresponding portions of mouse Hcrtr2 . This high degree of conservation explains the similar pharmacological profiles observed between species.

Species ComparisonAmino Acid Identity with Human HCRTR2Notes
Mouse Hcrtr292% (extracellular portions)High conservation in ligand-binding domains
Rat Hcrtr293% (extracellular portions)Slightly higher conservation than mouse

The functional conservation between mouse and human HCRTR2 is evident in their similar roles in sleep-wake regulation, with genetic disruption of the receptor in both species resulting in narcolepsy-like phenotypes . This high degree of structural and functional conservation makes mouse models valuable for translational research on sleep disorders and potential therapeutic interventions.

What signaling pathways are activated by Mouse Hcrtr2 stimulation?

Mouse Hcrtr2 is capable of coupling to multiple G proteins, leading to diverse downstream signaling cascades. While most research on signaling pathways has been conducted in human systems, the high homology suggests similar mechanisms in mouse Hcrtr2. The receptor can activate Gi, Gs, and Gq proteins, with different physiological outcomes depending on the specific G-protein coupling .

G-Protein TypeMajor Signaling OutcomePhysiological Effect
Gq↑ Phospholipase C → ↑ Ca²⁺Neuronal excitation, increased wakefulness
Gi↓ Adenylyl cyclase → ↓ cAMPModulation of reward pathways
Gs↑ Adenylyl cyclase → ↑ cAMPMetabolic effects

A key signaling event following Hcrtr2 activation is the increase in cytoplasmic Ca²⁺ levels in response to orexin-A binding . This calcium mobilization contributes to the excitatory effects of orexin signaling in neurons, particularly those involved in maintaining wakefulness. When designing experiments to study these pathways in recombinant systems, researchers should include appropriate assays to measure calcium flux, cAMP levels, or other second messengers depending on the specific pathway under investigation.

How does selective antagonism of Hcrtr2 compare with dual Hcrtr1/2 antagonism in sleep studies?

Comparative studies between selective Hcrtr2 antagonists and dual Hcrtr1/2 antagonists reveal significant differences in their effects on sleep architecture. In research comparing the HCRTR2-selective antagonist EMPA with the dual HCRTR1/R2 antagonist almorexant, several key distinctions emerged:

Antagonist TypeEffect on Non-REM SleepEffect on REM SleepSleep LatencySleep Architecture
HCRTR2-selective (EMPA)Significant increase only at highest dosesMinimal effectMinor reductionMinimal fragmentation
HCRTR1-selective (SB-334867)Small increaseSmall increaseMinor reductionMinimal effect
Dual HCRTR1/R2 (Almorexant)Substantial increaseProportional increaseSignificant reductionIncreased NR bouts; potential fragmentation at high doses

The research conclusively demonstrates that dual HCRTR1/R2 blockade is more effective in promoting sleep than blockade of either receptor alone . This finding suggests that both receptors contribute to sleep-wake regulation through complementary mechanisms. At the highest dose tested (100 mg/kg), almorexant did fragment sleep architecture by increasing the number of waking and REM bouts, indicating dose-dependent effects that researchers should consider when designing experiments .

A particularly interesting observation is that HCRTR1 occupancy by almorexant declined 4-6 hours post-administration while HCRTR2 occupancy remained elevated after 12 hours, revealing a complex relationship between receptor occupancy and sleep promotion . This temporal dissociation provides valuable insight for designing time-course experiments when studying these receptors.

What methodologies are recommended for investigating the role of Hcrtr2 in reward circuits?

When investigating Hcrtr2's role in reward circuits, researchers should employ a multi-modal approach that combines genetic, pharmacological, and behavioral techniques. The involvement of Hcrtr2 in addiction and reward processing requires careful experimental design to dissect its specific contributions.

For genetic approaches, conditional knockout models are preferred over constitutive knockouts, as they allow temporal and spatial control of Hcrtr2 expression. This approach helps distinguish between developmental effects and acute roles of the receptor in adult reward circuits. Cre-loxP systems targeting specific neuronal populations can be particularly informative.

Pharmacological studies should include:

  • Selective Hcrtr2 antagonists (such as EMPA) compared with dual antagonists

  • Dose-response relationships to determine threshold effects

  • Time-course analyses to capture the temporal dynamics of receptor activation

  • Control experiments with Hcrtr1 antagonists to distinguish receptor-specific effects

Behavioral paradigms should be selected based on the specific reward process under investigation:

Reward-Related BehaviorRecommended ParadigmKey Measurements
Drug rewardConditioned place preference, self-administrationAcquisition rate, extinction, reinstatement
Food rewardOperant conditioning, progressive ratioBreakpoint, response rate, consumption patterns
Natural rewardsSocial preference, sexual behaviorApproach behaviors, consummatory responses

Neurochemical measurements (microdialysis, fast-scan cyclic voltammetry) should be incorporated to correlate Hcrtr2 activity with dopamine or other neurotransmitter release in reward-relevant brain regions.

How can researchers effectively study Hcrtr2 involvement in narcolepsy models?

Investigating Hcrtr2's role in narcolepsy requires careful consideration of model systems and phenotypic assessments. Since engagement of HCRTRs in mouse brain promotes wakefulness, and absence of either orexins or their receptors creates a narcolepsy-like state , several approaches can be employed:

  • Genetic models:

    • Hcrtr2 knockout mice

    • Conditional Hcrtr2 knockouts for temporal control

    • Knockin models expressing human mutations associated with narcolepsy

  • Pharmacological models:

    • Selective Hcrtr2 antagonists (timing and dosage are critical)

    • Dual Hcrtr1/Hcrtr2 antagonists for comparison

Essential phenotypic assessments should include:

Assessment TypeMethodologyKey Parameters
Sleep architecturePolysomnography (EEG/EMG)REM/NREM transitions, sleep onset REM periods (SOREMPs)
Cataplexy-like episodesVideo monitoring, EMGFrequency, duration, triggering factors
Circadian rhythmicityActivity monitoring, temperaturePhase shifts, fragmentation patterns
Cognitive performanceNovel object recognition, T-mazeWorking memory, attention lapses

When analyzing data from narcolepsy models, researchers should pay particular attention to:

  • The temporal distribution of sleep-wake transitions throughout the 24-hour cycle

  • The relationship between cataplexy-like episodes and emotionally salient stimuli

  • Potential compensatory mechanisms that may emerge in chronic models

  • The distinction between direct effects of Hcrtr2 absence versus secondary consequences

What are best practices for validating recombinant Mouse Hcrtr2 expression systems?

Validating recombinant Mouse Hcrtr2 expression systems requires multiple complementary approaches to ensure both expression and functionality of the receptor. The following validation strategy is recommended:

  • Expression verification:

    • Western blotting with specific anti-Hcrtr2 antibodies

    • Immunocytochemistry to confirm membrane localization

    • Quantitative PCR to verify transcript levels

    • Flow cytometry for cell surface expression quantification

  • Functional validation:

    • Ligand binding assays with labeled orexin-A and orexin-B

    • Calcium mobilization assays following orexin treatment

    • cAMP assays to assess G-protein coupling

    • Receptor internalization studies to confirm trafficking

Validation MethodPurposeAcceptance Criteria
Saturation bindingDetermine Bmax and KdSpecific binding with Kd in expected range (nM)
Competitive bindingCompare affinities of ligandsKi values consistent with literature
Calcium fluxFunctional responseDose-dependent increase in Ca²⁺ with EC50 in expected range
Antagonist testingPharmacological validationDose-dependent inhibition with expected IC50 values

When establishing stable cell lines expressing recombinant mouse Hcrtr2, researchers should consider using inducible expression systems to control for potential toxic effects of constitutive expression. Additionally, the choice of host cell is critical, as some cell types may lack components of the signaling machinery required for full receptor functionality.

How should researchers design experiments to distinguish Hcrtr1 vs Hcrtr2 mediated effects?

Distinguishing between Hcrtr1 and Hcrtr2 mediated effects requires careful experimental design that leverages the differential pharmacology, expression patterns, and functional outcomes of these receptors:

  • Pharmacological approach:

    • Use of selective antagonists (SB-334867 for Hcrtr1; EMPA for Hcrtr2)

    • Comparison with dual antagonists (almorexant)

    • Dose-response relationships to identify receptor-specific thresholds

  • Genetic approach:

    • Knockout models (single vs double)

    • Tissue-specific conditional knockouts

    • Knockdown strategies (siRNA, shRNA) for acute manipulation

  • Expression analysis:

    • Correlation of effects with known expression patterns

    • Single-cell analysis to identify cells expressing one or both receptors

When interpreting results, researchers should consider the 64% sequence identity between Hcrtr1 and Hcrtr2 , which can lead to cross-reactivity of some tools. A comprehensive approach that combines multiple lines of evidence is therefore recommended:

ApproachStrengthsLimitationsMitigation Strategy
Selective antagonistsAcute, reversible effectsPotential off-target actions at high dosesUse multiple chemically distinct antagonists
Genetic deletionComplete elimination of receptorCompensatory changes during developmentUse inducible knockout systems
RNAi approachesCell-type specificity possibleIncomplete knockdownValidate knockdown efficiency at protein level

The temporal dynamics of receptor occupancy should also be considered, as demonstrated by the differential time courses of Hcrtr1 and Hcrtr2 occupancy observed with almorexant .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.