Recombinant Mouse Organic solute transporter subunit alpha (Osta)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression Systems

Osta has been produced in multiple recombinant systems, each offering distinct advantages:

Expression SystemCodeSourceKey Features
YeastCSB-YP851240MO1Saccharomyces cerevisiaeHigh purity; suitable for structural studies
E. coliCSB-EP851240MO1Escherichia coliCost-effective; includes biotinylated variants (e.g., CSB-EP851240MO1-B)
BaculovirusCSB-BP851240MO1Insect cells (Sf9/Sf21)High yield; post-translational modifications
Mammalian cellsCSB-MP851240MO1HEK293 or CHO cellsNative glycosylation; functional activity in transport assays

Data compiled from commercial and research sources .

Role in Bile Acid Transport

  • Osta-Ostβ facilitates basolateral efflux of bile acids in ileal enterocytes, completing the enterohepatic circulation .

  • Knockout studies in mice show severe bile acid malabsorption, confirming its physiological necessity .

Regulation and Disease Associations

  • Transcriptional regulation: Expression is upregulated by the farnesoid X receptor (FXR) during cholestasis, protecting against hepatotoxicity .

  • Pathological relevance: Elevated in nonalcoholic steatohepatitis (NASH) and cholestatic liver diseases, suggesting a role in disease progression .

Functional Dependence on Ostβ

  • Ostβ stabilizes Osta and enables its plasma membrane localization .

  • Deletion of Ostβ’s transmembrane domain abolishes bile acid transport activity .

Applications in Biomedical Research

  • Drug interaction studies: Osta-Ostβ transports prostaglandin E2 and digoxin, informing pharmacokinetic predictions .

  • Cholestasis models: Used to investigate bile acid dysregulation and therapeutic targets .

  • Structural biology: Biotinylated variants (e.g., CSB-EP851240MO1-B) enable pull-down assays for interaction mapping .

Challenges and Future Directions

  • Mechanistic gaps: The exact stoichiometry and transport mechanism of the Ostα-Ostβ complex remain unresolved .

  • Therapeutic potential: Targeting Osta-Ostβ could modulate bile acid flux in metabolic or cholestatic disorders .

Product Specs

Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock. However, if you have any special requirements for the format, please indicate them in your order notes. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
Slc51a; Osta; Organic solute transporter subunit alpha; OST-alpha; Solute carrier family 51 subunit alpha
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-340
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Slc51a
Target Protein Sequence
MEPGRTHIKLDPRYTAELLELLETNYSISPACFSHPPTAAQLLRALGPVDIALTIILTFL TTGSVAIFLEDAVYLYKNTLCPIKKRTLIWSSSAPTVVSVFCCFGLWIPRALTLVEMAIT SFYAVCFYLLMMVMVEGFGGKKAVLRTLKDTPMRVHTGPCCCCCPCCPPLILTRKKLQLL LLGPFQYAFFKITLSIVGLFLIPDGIYDPGEISEKSAALWINNLLAVSTLLALWSLAILF RQAKMHLGEQNMGSKFALFQVLVILTALQPAIFSILANSGQIACSPPYSSKIRSQVMNCH MLILETFLMTVLTRMYYRRKDDKVGYEACSLPDLDSALKA
Uniprot No.

Target Background

Function
The organic solute transporter alpha subunit (Ost-alpha) is a crucial component of the Ost-alpha/Ost-beta complex, a heterodimer that functions as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood. This complex efficiently transports the primary species of bile acids.
Gene References Into Functions
  1. Studies suggest that the transport of bile acid taurocholate is maintained even when the OstB (organic solute transporter beta subunit) is truncated to contain only the transmembrane domain with 15 additional residues on each side and co-expressed with intact OstA. Shorter fragments of OstB are inactive. PMID: 28455390
  2. These findings indicate that loss of OSTalpha protects against age-related weight gain and insulin resistance. PMID: 24381083
  3. Ileal FGF15 expression was directly correlated with plasma cholesterol levels and aortic cholesterol content. In contrast, plasma and hepatic cholesterol levels and atherosclerosis development were not reduced in apoE(-/-) mice deficient in Ostalpha. PMID: 23880190
  4. Total ileal FGF15 expression was elevated almost 20-fold in Ostalpha(-/-) mice as a result of increased villus epithelial cell number and ileocyte FGF15 protein expression PMID: 22542490
  5. Inactivation of FXR largely unmasked the bile acid malabsorption phenotype and corrected the bile acid homeostasis defect in Ostalpha null mice. PMID: 21691100
  6. Ostalpha-deficient mice efficiently eliminate excess bile acids via the feces. PMID: 21719738
  7. OSTalpha is localized to steroidogenic cells of the brain and adrenal gland, and it modulates DHEA/DHEAS homeostasis PMID: 20649839
  8. These findings indicate that loss of Ostalpha provides protection from liver injury in obstructive cholestasis through adaptive responses in both the kidney and liver that enhance clearance of bile acids into urine. PMID: 19902485
  9. Co-expression of mouse Ostalpha-Ostbeta, but not the individual subunits, stimulated Na(+)-independent bile acid uptake and the apical-to-basolateral transport of taurocholate PMID: 15563450
  10. OSTalpha and OSTbeta mRNA levels were induced in the adrenals and kidneys of wild-type, but not FXR-/-, mice PMID: 16251721
  11. The selective localization of OSTalpha and OSTbeta to the basolateral plasma membrane of epithelial cells responsible for bile acid and sterol reabsorption. PMID: 16317684
  12. In conclusion, we identified Ost-alpha/Ost-beta as a novel FXR target. Absent Ost-alpha/Ost-beta induction in CA-fed FXR(-/-) animals may contribute to increased liver injury in these animals. PMID: 16357057
  13. The mouse Ostalpha and Ostbeta promoters are unusual in that they contain functional FXR and LRH elements, which mediate, respectively, positive and negative feedback regulation by bile acids. PMID: 16357058
  14. These results indicate that expression of Ostalpha and Ostbeta are highly regulated in response to cholestasis and that this response is dependent on the FXR bile acid receptor. PMID: 16423920
  15. LXRalpha transcriptionally regulate mouse organic solute transporter alpha/beta via inverted repeat-1 elements shared with farnesoid X receptor PMID: 17177110
  16. Present as heterodimers (with Ost beta) and/or heteromultimers; the interaction between Ostalpha and Ostbeta increases the stability of the proteins and is required for delivery of the heteromeric complex to the plasma membrane. PMID: 17650074
  17. These data indicate that Ostalpha-Ostbeta is essential for intestinal bile acid transport in mice. PMID: 18292224
  18. These findings provide direct support for the hypothesis that Ostalpha-Ostbeta is a major basolateral transporter of bile acids and conjugated steroids in the intestine, kidney, and liver. PMID: 18497332

Show More

Hide All

Database Links
Protein Families
OST-alpha family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Note=Mainly restricted to the lateral and basal membranes of ileal enterocytes. Transported from the endoplasmic reticulum to the plasma membrane upon interacting with SLC51B.
Tissue Specificity
Present at high levels in ileum. In ileum, it is restricted to the apical domain on the mature villus enterocytes with little detectable expression in the goblet cells or crypt enterocytes (at protein level). Expressed in kidney but not in heart, brain, l

Q&A

What is Organic Solute Transporter alpha/beta (OSTα/β)?

OSTα/β is a heteromeric solute carrier protein composed of two distinct subunits (OSTα and OSTβ) that together form a functional transporter for bile acids, steroid metabolites, and various drugs. The transporter operates bidirectionally, facilitating both the influx and efflux of substrates across cell membranes . In mammals, the genes encoding OSTα and OSTβ are transcribed from different chromosomes - in humans, they are located on chromosomes 3q29 and 15q22.31, respectively . The OSTα/β complex differs from many other transporters in that both subunits are absolutely required for function, with neither subunit capable of independent transport activity in mammalian systems . This heteromeric system belongs to the SLC51 subfamily of solute carrier transporters, with OSTα designated as SLC51A and OSTβ as SLC51B .

Where is OSTα/β expressed in mouse tissues?

OSTα/β shows a tissue-specific expression pattern with highest levels observed in the gastrointestinal tract, particularly in the ileum, where it plays a crucial role in the enterohepatic circulation of bile acids . The transporter is localized at the basolateral membrane of epithelial cells in multiple tissues including intestine, kidney, liver, testis, and adrenal gland . In these tissues, OSTα/β facilitates the transport of bile acids and other substrates from the cytoplasm into the bloodstream, particularly important for the recirculation of bile acids from the intestine to the liver . Expression levels of OSTα and OSTβ can vary across tissues, suggesting potential tissue-specific regulation of the transporter . The differential expression pattern of OSTα/β across tissues likely reflects its specialized role in maintaining bile acid homeostasis in the enterohepatic system.

How do OSTα and OSTβ subunits interact to form a functional transporter?

The formation of a functional OSTα/β transporter requires physical association between the two subunits, as demonstrated through various experimental approaches. Protein-protein interactions between human OSTα and OSTβ have been confirmed through mammalian two-hybrid analysis and co-immunoprecipitation studies . The subunits mutually stabilize each other when co-expressed, with significantly longer half-lives observed for both proteins in co-transfected cells compared to singly expressed proteins . Transport assays in transfected cells demonstrate that cells expressing both OSTα and OSTβ show a three- to five-fold increase in taurocholate influx or efflux compared to cells expressing individual subunits or non-transfected controls . Confocal microscopy studies have further confirmed the co-localization of OSTα and OSTβ at the plasma membrane in co-transfected cells, providing visual evidence of their physical association .

What structural domains of OSTα are critical for interaction with OSTβ?

Research has identified several critical domains in OSTα that mediate its interaction with OSTβ. The amino-terminal extracellular region of OSTα plays a particularly important role in heterodimer formation and trafficking. Truncation experiments have demonstrated that deletion of the amino-terminal 50 amino acid extracellular residues of human OSTα abolishes interaction with OSTβ, resulting in intracellular accumulation of both proteins and loss of transport function . This suggests that the N-terminal domain contains essential information for heterodimer assembly and proper trafficking to the plasma membrane . In contrast, truncation of the carboxyl-terminal 28 amino acid cytoplasmic domain of OSTα does not prevent interaction with OSTβ, and the resulting truncated complex still reaches the basolateral membrane in stably transfected MDCK cells . These findings indicate that while the C-terminal domain may have other functions, it is not essential for the physical association between the subunits or their membrane targeting.

What conserved motifs are present in OSTα and OSTβ, and what are their functions?

Both OSTα and OSTβ contain several conserved sequence motifs that are likely important for their function and regulation. OSTα contains a characteristic "Solute_trans_a" domain that is critical for its transport function . A highly conserved pattern of cysteine residues is present in vertebrate OSTα proteins, with OSTα from higher vertebrates containing five conserved cysteine residues . While their exact function is unclear, these cysteine residues may participate in substrate binding or in the interaction with OSTβ . Another important motif present in both OSTα and OSTβ is the Arg-X-Arg (RXR) motif, which has been identified in various forms (RWR, RKR, RRR) in OSTα proteins across species . The RXR motif serves as a retrieval signal that prevents transport of inappropriately assembled complexes from the endoplasmic reticulum . In OSTβ, a di-leucine (LL) motif has been identified that may function as an additional determinant preventing cell surface expression of single subunits or misassembled complexes .

How does the expression of OSTα/β change in pathological conditions?

OSTα/β expression is dynamically regulated in response to pathological conditions, particularly those involving alterations in bile acid homeostasis. Studies have established that OSTα/β is significantly upregulated in liver tissue of patients with various forms of cholestasis, including extrahepatic cholestasis, obstructive cholestasis, and primary biliary cholangitis (PBC) . These conditions are characterized by elevated bile acid concentrations in the liver and/or systemic circulation, suggesting that increased OSTα/β expression may represent an adaptive response to facilitate bile acid efflux from hepatocytes . Of particular clinical relevance is the discovery that OSTα/β is highly upregulated in the liver of patients with nonalcoholic steatohepatitis (NASH), a condition whose incidence is increasing rapidly with the obesity epidemic . This upregulation likely represents a compensatory mechanism to protect hepatocytes from the cytotoxic effects of accumulated bile acids, highlighting OSTα/β as a potential therapeutic target in liver diseases associated with disrupted bile acid homeostasis.

What expression systems are optimal for studying recombinant mouse OSTα?

Several expression systems have been successfully employed to study recombinant OSTα/β, each with specific advantages for different research questions. Human embryonic kidney (HEK) 293 cells have been widely used for co-expression studies of OSTα and OSTβ, allowing investigation of protein-protein interactions, stability, and transport function . These cells have relatively low background expression of endogenous transporters and are readily transfectable. Madin-Darby canine kidney (MDCK) cells provide an excellent system for studying polarized expression of OSTα/β, as they form well-defined epithelial monolayers with distinct apical and basolateral domains . This system is particularly valuable for examining the targeting of OSTα/β to the basolateral membrane. African green monkey kidney fibroblast-like COS-7 cells have been utilized for transport studies, demonstrating increased uptake of taurocholate and estrone sulfate in cells co-expressing both subunits . For electrophysiological studies and rapid functional assessments, Xenopus laevis oocytes offer a robust system where individual subunits can reach the plasma membrane independently, though both are required for transport activity .

What techniques are most effective for studying OSTα/β protein-protein interactions?

Several complementary techniques have proven effective for investigating the protein-protein interactions between OSTα and OSTβ subunits:

TechniqueApplicationKey Findings
Mammalian two-hybrid assayDetection of direct protein interactionsConfirmed physical association between OSTα and OSTβ
Co-immunoprecipitationVerification of protein complex formationDemonstrated that OSTα and OSTβ exist in a physical complex
Confocal microscopyVisualization of protein co-localizationShowed co-localization of OSTα and OSTβ at the plasma membrane
Truncation/mutation studiesIdentification of interaction domainsRevealed the importance of N-terminal domain of OSTα for interaction
Cycloheximide chase experimentsAssessment of protein stabilityDemonstrated mutual stabilization of subunits with half-life >24 hours when co-expressed

These techniques have collectively established that OSTα and OSTβ form a stable heteromeric complex, with specific domains mediating their interaction and influencing their trafficking to the plasma membrane . For researchers studying mouse OSTα, these approaches can be adapted to investigate species-specific aspects of subunit interaction and potential regulatory mechanisms.

How can OSTα/β transport activity be quantified in experimental systems?

Quantification of OSTα/β transport activity can be accomplished through several experimental approaches depending on the specific research questions and available resources:

Radiolabeled substrate uptake/efflux assays represent the gold standard for quantifying transport activity. Studies have demonstrated increased uptake and efflux of radiolabeled taurocholate (TCA) and estrone sulfate (ES) in cells co-expressing OSTα and OSTβ compared to cells expressing single subunits or non-transfected controls . These assays typically measure the initial rate of substrate transport (either influx or efflux) over a defined time period, with three- to five-fold increases observed in cells expressing both subunits . When designing these experiments, it's essential to include appropriate controls, such as cells expressing individual subunits and mock-transfected cells, to account for background transport activity . Additionally, transport assays should be performed at different substrate concentrations to determine kinetic parameters such as Km and Vmax, which provide insights into the affinity and capacity of the transporter.

What controls are essential when studying recombinant mouse OSTα in transfected systems?

When investigating recombinant mouse OSTα in transfected systems, several critical controls must be included to ensure valid and interpretable results:

Single subunit expression controls are essential since neither OSTα nor OSTβ alone exhibits significant transport activity in mammalian cells . Cells transfected with individual subunits serve as important negative controls for transport assays and allow researchers to distinguish the specific activity of the heteromeric complex. Protein expression verification through Western blotting or immunofluorescence is crucial to confirm successful expression of both subunits at appropriate levels . Without verification of protein expression, negative results in functional assays could be misinterpreted. Mock-transfected controls provide a baseline for endogenous transport activity in the chosen cell system and account for any non-specific effects of the transfection procedure . Time-course experiments should be conducted to determine the optimal time point for assessing transporter function, as the stability and trafficking of the OSTα/β complex take time to establish .

How does the stoichiometry of OSTα and OSTβ affect functional expression?

The relative expression levels of OSTα and OSTβ can significantly impact the functional expression of the transporter complex. In native tissues, OSTα and OSTβ can be expressed at different protein levels, suggesting potential variability in subunit stoichiometry . This may reflect unknown OSTα/β stoichiometry on the plasma membrane or variable intracellular expression of the subunits . When designing experiments with recombinant proteins, researchers should consider the potential impact of expression vector design, promoter strength, and transfection ratios on the relative levels of OSTα and OSTβ. Optimization experiments may be necessary to determine the ideal expression ratio for maximal transport activity. Some studies suggest that OSTβ may be the limiting factor in heterodimer formation and function, as its expression is more tightly regulated in some systems . Therefore, ensuring adequate OSTβ expression may be particularly important for achieving robust functional expression of the transporter complex.

What approaches can be used to study membrane trafficking of OSTα/β?

Understanding the trafficking of OSTα/β to the plasma membrane is crucial for comprehensive characterization of this transporter system. Several experimental approaches have proven effective:

Confocal microscopy with fluorescently tagged subunits allows real-time visualization of trafficking and membrane localization of OSTα and OSTβ . This approach can be particularly informative when combined with subcellular markers for different compartments of the secretory pathway. Surface biotinylation assays provide a biochemical method to quantify the proportion of OSTα and OSTβ that reaches the plasma membrane under different experimental conditions . This technique can complement microscopy approaches by providing quantitative data on surface expression. Domain truncation and mutation studies have been instrumental in identifying regions critical for membrane trafficking, such as the N-terminal domain of OSTα . These studies have revealed that truncation of the amino-terminal 50 amino acid residues of OSTα abolishes proper trafficking, leading to intracellular accumulation of both subunits . The use of trafficking inhibitors or temperature-sensitive trafficking blocks can help delineate the specific pathways involved in OSTα/β movement to the plasma membrane and identify potential rate-limiting steps in the process.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.