Recombinant Mouse ORM1-like protein 2 (Ormdl2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse ORM1-like protein 2 (Ormdl2)

Recombinant Mouse ORM1-like protein 2 (Ormdl2) is a genetically engineered form of the Ormdl2 protein, which plays a crucial role in regulating sphingolipid biosynthesis in mammals. This protein is part of the ORM family, which includes Ormdl1, Ormdl2, and Ormdl3, all involved in modulating the activity of the serine palmitoyltransferase (SPT) complex. The SPT complex is essential for the initial step of sphingolipid synthesis, a process vital for cellular membrane structure and signaling pathways.

Function of Ormdl2

Ormdl2 is primarily involved in the homeostatic regulation of sphingolipid de novo biosynthesis. It acts by modulating the activity of the SPT complex, which is responsible for converting serine and palmitoyl-CoA into 3-ketosphinganine, the first step in sphingolipid synthesis . This regulation is crucial for maintaining proper sphingolipid levels within cells, as dysregulation can lead to various cellular and physiological abnormalities.

Research Findings on Ormdl2

Recent studies have highlighted the importance of Ormdl2 in mast cell signaling and sphingolipid metabolism. For instance, the absence of Ormdl2 in mice (Ormdl2 knockout) does not significantly alter sphingolipid levels on its own but potentiates the effects of Ormdl3 deficiency, leading to increased sphingolipid synthesis and altered mast cell function . This suggests a redundant or cooperative role between Ormdl2 and Ormdl3 in regulating sphingolipid biosynthesis.

Table 1: Effects of Ormdl2 and Ormdl3 Deficiency on Sphingolipid Levels

GenotypeSphingosine LevelsCeramide Levels
WTBaselineBaseline
Ormdl2 KONo changeNo change
Ormdl3 KOIncreasedIncreased
Ormdl2,3 dKOFurther increasedFurther increased

Recombinant Mouse Ormdl2 Production

Recombinant Mouse Ormdl2 is produced through genetic engineering techniques, where the Ormdl2 gene is inserted into an expression vector and then expressed in a suitable host cell line. This allows for the large-scale production of the protein for research purposes .

Applications of Recombinant Mouse Ormdl2

The recombinant form of Ormdl2 is primarily used in research settings to study its role in sphingolipid metabolism and immune cell function. It can be used in experiments to modulate sphingolipid synthesis and observe the effects on cellular processes such as mast cell activation and cytokine production.

Table 2: Potential Applications of Recombinant Mouse Ormdl2

Application AreaDescription
Basic ResearchStudying sphingolipid biosynthesis and its regulation
ImmunologyInvestigating the role of Ormdl2 in mast cell signaling and immune responses
Therapeutic DevelopmentExploring potential targets for modulating sphingolipid metabolism in diseases

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
Ormdl2; ORM1-like protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Ormdl2
Target Protein Sequence
MNVGVAHSEVNPNTRVMNSRGIWLAYIILVGLLHVVLLSIPFFSIPVVWTLTNVIHNLAM YIFLHTVKGTPFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSISPIVLYLLASFYTKYD AAHFLINTASLLSVLLPKLPQFHGVRLFGINKY
Uniprot No.

Target Background

Function
Negative regulator of sphingolipid synthesis.
Database Links
Protein Families
ORM family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.