Recombinant Mouse ORM1-like protein 3 (Ormdl3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse ORM1-like protein 3 (Ormdl3)

Recombinant Mouse ORM1-like protein 3 (Ormdl3) is a genetically engineered version of the endogenous murine ORMDL3 protein, expressed in heterologous systems (e.g., bacterial, mammalian, or insect cells) for research purposes. ORMDL3, encoded by the ORMDL3 gene on chromosome 17q12-21, is a transmembrane protein localized to the endoplasmic reticulum (ER) and implicated in sphingolipid biosynthesis, ER stress responses, and inflammatory diseases like asthma . The recombinant form is used to study its mechanistic roles in vitro and in vivo, particularly in models of airway hyperresponsiveness (AHR), eosinophil function, and mast cell activity.

Expression and Production

Recombinant Ormdl3 is typically produced via:

  • Cloning: Mouse ORMDL3 cDNA is inserted into plasmid vectors (e.g., pcDNA3.1, pET-28a) under inducible promoters.

  • Expression Systems:

    • E. coli (for cost-effective production of soluble protein).

    • Mammalian cells (e.g., HEK293, CHO) to ensure proper post-translational modifications.

  • Purification: Affinity chromatography (e.g., His-tag, GST-tag) followed by size-exclusion chromatography to achieve high purity .

ParameterRecombinant Ormdl3 Production (Typical Values)
Expression SystemMammalian (HEK293) or Bacterial (E. coli)
Yield1–5 mg/L (bacterial); 0.1–1 mg/L (mammalian)
Purity>90% (via SDS-PAGE and Western blot)
Activity AssaySphingolipid biosynthesis inhibition (SPT assay)

Functional Roles in Research Models

Recombinant Ormdl3 is used to:

Study Airway Smooth Muscle (ASM) Pathophysiology

  • Hypertrophy/Hyperplasia: Overexpression in ASM cells induces tropomyosin (TPM1/TPM4) upregulation, promoting cell growth and proliferation .

  • Contractility: Increased intracellular Ca²⁺ influx via Orai1 channels and enhanced sarco/endoplasmic reticulum Ca²⁺ ATPase (SERCA2b) expression .

  • In Vivo AHR: Transgenic mice expressing human ORMDL3 in ASM (hORMDL3Myh11eGFP-cre) exhibit spontaneous AHR and airway remodeling .

Investigate Eosinophil Activation

  • Adhesion and Migration: ORMDL3 knockdown reduces α4 and β2 integrin expression, impairing adhesion to VCAM-1/ICAM-1 and eosinophil recruitment .

  • Degranulation: Regulates CD48-mediated degranulation and IL-3-induced ERK/NF-κB signaling .

Analyze Sphingolipid Metabolism

  • Inhibition of SPT: Binds to serine palmitoyltransferase (SPT), the rate-limiting enzyme in sphingolipid biosynthesis, reducing ceramides and sphingosine-1-phosphate (S1P) .

  • Serum Sphingolipid Levels: hORMDL3 transgenic mice show reduced sphinganine (↓20%), ceramide 24:0 (↓30%), and S1P (↓40%) .

ER Stress and Autophagy

  • ER Homeostasis: ORMDL3 interacts with LC3, influencing autophagic flux. Its loss in intestinal organoids impairs autophagy and induces ER dilation .

  • UPR Activation: Deficiency in ORMDL proteins reduces unfolded protein response (UPR) signaling in intestinal epithelial cells .

Calcium Signaling

  • Orai1 Regulation: Increased Orai1 expression on the ASM cell surface amplifies histamine-induced Ca²⁺ influx, driving hypercontractility .

Genetic Linkage to Asthma

  • SNP Associations: Polymorphisms in ORMDL3 (e.g., rs4378650) correlate with childhood asthma susceptibility and elevated ORMDL3 expression .

Experimental Applications

Recombinant Ormdl3 is applied in:

  • Transgenic Models: Human ORMDL3 (hORMDL3) overexpression in mice to study asthma pathogenesis .

  • Cell Culture: siRNA knockdown or GFP-tagged overexpression to dissect molecular pathways in ASM, eosinophils, and mast cells .

  • Biochemical Assays: SPT activity inhibition and sphingolipid profiling .

Table 1: Key Functional Outcomes of ORMDL3 Overexpression

Model/Cell TypeOutcomeMechanismCitation
ASM (hORMDL3Myh11eGFP-cre)Hypertrophy, hyperplasia, ↑TPM1/TPM4SPT inhibition, Ca²⁺ influx via Orai1
Eosinophils (ORMDL3 KD)↓Adhesion (VCAM-1/ICAM-1), ↓ERK/NF-κBReduced α4/β2 integrins, ↓CD48 expression
hORMDL3 zp3–Cre Mice↓Sphinganine, ↓Ceramide 24:0, ↓S1PSPT inhibition, ↓SPTLC activity
BMMCs (O1/3dKO)↓Size, ↓DegranulationImpaired autophagy, ER dilation

Table 2: Sphingolipid Levels in hORMDL3 Transgenic Mice

SphingolipidSerum Level (hORMDL3 vs. WT)Lung Level (hORMDL3 vs. WT)
Sphinganine↓20%↓10% (modest)
Ceramide 24:0↓30%↓15%
Sphingosine↓25%N/A
S1P↓40%↓20%

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: If a specific tag type is required, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
Ormdl3; ORM1-like protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Ormdl3
Target Protein Sequence
MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNLGM YIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYD QVHFILNTVSLMTVLIPKLPQLHGVRIFGINKY
Uniprot No.

Target Background

Function
Recombinant Mouse ORM1-like protein 3 (Ormdl3) acts as a negative regulator of sphingolipid synthesis and may indirectly modulate endoplasmic reticulum-mediated Ca2+ signaling.
Gene References Into Functions
  1. Elevated ORMDL3, phosphorylated ERK (pERK), and MMP9 expression were observed in an asthma model, significantly reduced by budesonide pretreatment. PMID: 28358425
  2. ORMDL3 modulates autophagy via the ATF6-Beclin1 pathway, promoting splenic B cell survival through autophagy and apoptosis suppression. PMID: 28747345
  3. ORMDL3 may influence de novo sphingolipid metabolism downstream of serine palmitoyltransferase. PMID: 27645259
  4. Inhibition of ORMDL3 in airway epithelial cells significantly impacts allergen-induced airway hyperresponsiveness. PMID: 28275141
  5. Identified by genome-wide association studies, ORMDL3 contributes to pathways altering airway physiology during allergic immune responses. PMID: 27623174
  6. ORMDL3 expression is mediated by GATA3 through its promoter region. PMID: 28031110
  7. ORMDL3 downregulation in mast cells enhances AKT and NF-κB signaling, chemotaxis, and mast cell-mediated inflammation in vivo. PMID: 26407610
  8. ORMDL3 overexpression complexly regulates cellular ceramide homeostasis; local FTY720 administration may be a therapeutic option for allergic asthma. PMID: 25842287
  9. ORMDL3's contribution to asthma risk may involve sphingolipid metabolism alterations. PMID: 25691431
  10. ORMDL3 plays a crucial in vivo role in airway remodeling, potentially through ATF6 target genes. PMID: 24623133
  11. ORMDL3 promotes eosinophil trafficking and activation by regulating CD18, CD49d, and CD48. PMID: 24056518
  12. The cAMP/PKA/CREB signaling pathway significantly regulates ORMDL3 expression. PMID: 23577138
Database Links
Protein Families
ORM family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and localization of ORMDL3?

ORMDL3 is an ER-resident transmembrane protein with a molecular mass of approximately 17 kDa. It belongs to a family of highly conserved proteins that includes ORMDL1, ORMDL2, and ORMDL3. The protein is primarily localized in the endoplasmic reticulum membrane where it serves as a regulator of sphingolipid biosynthesis .
Structurally, when complexed to serine palmitoyltransferase (SPT), the binding of ceramides to its N-terminus stabilizes a conformation that blocks SPT substrate entry, thereby inhibiting SPT catalytic activity. This mechanism maintains ceramide levels at concentrations sufficient for complex sphingolipid production while preventing accumulation to levels that might trigger apoptosis .

How evolutionarily conserved is ORMDL3 across species?

ORMDL3 shows remarkable evolutionary conservation across mammalian species. Mouse ORMDL3 exhibits 96% homology with human ORMDL3 at the protein level, suggesting critical functional importance . This high degree of conservation extends to the other family members as well:

ORMDL IsoformHuman-Mouse Identity
ORMDL199%
ORMDL297%
ORMDL396%
The striking conservation between species suggests that all three isoforms likely have distinct, evolutionarily preserved functions. In yeast, there are two ORM genes that serve as homologs to the mammalian ORMDL proteins .

How is ORMDL3 expression regulated in different tissues and cellular contexts?

ORMDL3 expression varies across tissues and can be induced by various stimuli. In mouse models, ORMDL3 is:

  • Expressed ubiquitously in adult and fetal tissues, including the lung

  • Predominantly expressed in airway epithelial cells and endothelial cells under basal conditions

  • Significantly upregulated in inflammatory cells (particularly eosinophils) recruited to allergic airways after allergen challenge

  • Expressed at significantly higher levels in bone marrow-derived eosinophils compared to ORMDL1 and ORMDL2

  • Induced by specific cytokines, particularly IL-3 and eotaxin-1, but not by IL-5 or RANTES in eosinophils

  • Upregulated in response to allergen exposure in lung tissue, with expression patterns that are allergen-specific
    In humans, individuals carrying risk SNPs in the 17q12-21 locus show the most dramatic changes in ORMDL3 expression in immune cells, with CD4+ T lymphocytes exhibiting a 3-fold increase in ORMDL3 mRNA .

What transgenic mouse models are available for studying ORMDL3 function?

Several transgenic mouse models have been developed to study ORMDL3 function:

  • Global ORMDL3 overexpression models:

    • hORMDL3 zp3-Cre mice: Overexpress human ORMDL3 universally in all cells

    • These mice spontaneously develop increased airway remodeling, including increased airway smooth muscle, subepithelial fibrosis, and mucus production

  • Tissue-specific ORMDL3 overexpression models:

    • hORMDL3 Myh11eGFP-cre mice: Express human ORMDL3 selectively in smooth muscle cells

    • Generated using Cre-loxP techniques by crossing RFP-Stop-floxed hORMDL3-Tg mice with Myh11-cre eGFP mice

    • Exhibit ASM hypertrophy, hyperplasia, and increased contractility

  • Tissue-specific ORMDL3 knockout models:

    • β-cell-specific Ormdl3 knockout mice: Created using β-cell-specific Cre recombinase driven by the rat insulin promoter

    • Used to study ORMDL3's role in β-cell function and glucose homeostasis

  • Models for studying neutrophilic inflammation:

    • ORMDL3 overexpressing mice challenged with LPS/OVA to study neutrophilic inflammation in severe asthma
      When selecting the appropriate model, researchers should consider whether to study gain-of-function or loss-of-function effects, and whether to examine effects in specific tissues or systemically.

What methods are effective for detecting and quantifying ORMDL3 expression?

Several complementary approaches can be used to detect and quantify ORMDL3:
RNA Detection Methods:

  • RT-PCR and qPCR for mRNA expression analysis

  • Specific primer sets to differentiate between human ORMDL3 and mouse Ormdl3

  • Copy number quantification to compare expression levels across different models and tissues
    Protein Detection Methods:

  • Western blot analysis using polyclonal antibodies against ORMDL3

    • Primary band at ~17 kDa corresponding to ORMDL3's molecular weight

    • Additional bands in the ~45-70 kDa range may be present

  • Immunohistochemistry for tissue localization

  • Dual immunofluorescence staining to confirm cell-specific expression
    Validation Considerations:

  • Due to >80% homology between ORMDL1, ORMDL2, and ORMDL3, antibody cross-reactivity should be considered

  • Validating antibody specificity using recombinant proteins (e.g., His-tagged human ORMDL3 or GST-tagged mouse ORMDL3)

  • Incorporating appropriate positive and negative controls, including tissue from knockout models

How can researchers effectively manipulate ORMDL3 expression for functional studies?

Researchers can employ several techniques to modulate ORMDL3 expression:
Overexpression Approaches:

  • Transfection with ORMDL3-GFP fusion constructs in cell lines

  • Viral vectors for delivering ORMDL3 to primary cells

  • Creation of stable cell lines expressing ORMDL3 under inducible promoters
    Knockdown/Knockout Approaches:

  • siRNA-mediated knockdown for transient reduction (demonstrated effective in eosinophils)

  • shRNA for more stable knockdown

  • CRISPR-Cas9 for gene knockout in cell lines

  • Tissue-specific Cre-loxP knockout systems in mice
    Single Base Editing:

  • Cytosine Base Editor (CBE) approaches have been used to change the C risk allele of SNP rs12603332 to the T non-risk allele in human T cells (Jurkat and primary human CD4 cells)

  • This method uses a catalytically impaired CRISPR-associated nuclease [nCas9(D10A)] complexed with a guide RNA, fused to the cytosine deaminase enzyme rAPOBEC1 for targeted C-U conversion
    Functional Validation:

  • Confirm altered expression at both mRNA and protein levels

  • Assess functional consequences using appropriate cellular assays

  • For in vivo models, perform comprehensive phenotyping including baseline and challenged conditions

How does ORMDL3 regulate airway smooth muscle function in asthma pathogenesis?

ORMDL3 has significant effects on airway smooth muscle (ASM) that contribute to asthma pathophysiology:
ASM Hypertrophy and Hyperplasia:

  • Selective expression of ORMDL3 in ASM (hORMDL3 Myh11eGFP-cre mice) induces both ASM hypertrophy and hyperplasia

  • ASM cells from these mice show increased cell size (hypertrophy) as quantitated by FACS and image analysis

  • ORMDL3-expressing ASM cells demonstrate increased proliferation (hyperplasia) assessed by BrdU incorporation

  • This occurs without changes in expression of extracellular matrix proteins
    Molecular Mechanisms:

  • ORMDL3 expression in ASM upregulates tropomyosin proteins TPM1 and TPM4

  • siRNA knockdown experiments revealed that TPM1 and TPM4 mediate ORMDL3-induced ASM proliferation but not hypertrophy

  • ORMDL3 also increases expression of contractile genes, including Serca2b and Sm22
    Calcium Regulation and Contractility:

  • ASM derived from hORMDL3 Myh11eGFP-cre mice shows increased contractility to histamine in vitro

  • This is associated with increased levels of intracellular Ca²⁺

  • ORMDL3 increases cell surface membrane Orai1 Ca²⁺ channels, which mediate calcium influx into the cytoplasm
    In vivo Effects:

  • hORMDL3 Myh11eGFP-cre mice spontaneously develop increased ASM without environmental stimuli

  • These mice exhibit airway hyperreactivity (AHR) even without allergen challenge
    These findings establish ORMDL3 as a key regulator of ASM function in asthma, providing a mechanistic link between genetic risk factors and pathophysiological changes in airway structure and function.

What role does ORMDL3 play in regulating immune cell function, particularly in eosinophils and T cells?

ORMDL3 has significant regulatory effects on multiple immune cell types:
Effects on Eosinophils:

  • ORMDL3 is expressed by eosinophils recruited to airways after allergen challenge

  • ORMDL3 overexpression in eosinophils causes:

    • Increased rolling on vascular cell adhesion molecule-1 (VCAM-1)

    • Distinct cytoskeletal rearrangement

    • Extracellular signal-regulated kinase (1/2) phosphorylation

    • Nuclear translocation of nuclear factor kappa B (NF-κB)

  • Knockdown of ORMDL3 significantly inhibits:

    • Activation-induced cell shape changes

    • Adhesion and recruitment to inflammation sites in vivo

    • Expression of CD49d and CD18 integrins

  • ORMDL3 regulates IL-3-induced expression of CD48 and CD48-mediated eosinophil degranulation
    Effects on T Cells:

  • CD4+ T cells show a 3-fold increase in ORMDL3 mRNA in individuals with 17q12-21 risk SNPs

  • Enhanced ORMDL3 expression in T cells has functional consequences:

    • Reduced expression of interleukin-2 (IL-2)

    • Increased basal cytosolic calcium levels

    • Decreased extracellular calcium influx upon T cell receptor stimulation

    • Inhibition of calcium release-activated currents (ICRAC)

    • Reduced store-operated calcium entry (SOCE)

    • Decreased nuclear translocation of nuclear factor of activated T-cells (NFAT)

  • These alterations affect T cell activation and differentiation, potentially contributing to asthma pathogenesis
    Effects on Neutrophils:

  • In a mouse model of severe asthma with neutrophilic inflammation, ORMDL3 overexpression reduces neutrophil infiltration into the lung

  • This is associated with decreased IL-17, which plays a key role in neutrophilic asthma

  • ORMDL3 overexpression reduces circulating levels of sphingosine-1-phosphate (S1P), which can regulate neutrophil survival and recruitment
    These findings demonstrate that ORMDL3 has complex and cell type-specific effects on immune function, with significant implications for inflammatory diseases.

How does ORMDL3 regulate sphingolipid biosynthesis and what are the downstream consequences?

ORMDL3 is a critical regulator of sphingolipid metabolism:
Mechanistic Regulation of Sphingolipid Synthesis:

  • ORMDL3 negatively regulates serine palmitoyltransferase (SPT), the first and rate-limiting enzyme in sphingolipid biosynthesis

  • When complexed to SPT, ceramide binding to ORMDL3's N-terminus stabilizes a conformation that blocks SPT substrate entry

  • This mechanism maintains ceramide at sufficient levels for complex sphingolipid production while preventing accumulation to levels that trigger apoptosis
    Evidence from Transgenic Models:

  • ORMDL3 overexpression in mice reduces lung and circulating levels of dihydrosphingosine, the product of SPT

  • The most prominent effect observed is reduction of circulating sphingosine-1-phosphate (S1P)

  • In β-cell-specific Ormdl3 knockout mice fed high-fat diet, there are increases in very long chain ceramides (C22-C26) and long chain C16 ceramide
    Functional Consequences of Altered Sphingolipid Metabolism:

  • Sphingolipids are crucial for:

    • Membrane structure and rigidity

    • Cell identity

    • Immune signaling (particularly S1P and ceramide)

    • Regulation of cell survival and apoptosis
      Disease Implications:

  • Altered sphingolipid levels affect immune cell function and inflammatory responses:

    • S1P regulates neutrophil survival and recruitment following LPS airway inflammation

    • S1P potentiates LPS-induced chemotaxis of neutrophils

    • Altered sphingolipid metabolism affects T cell differentiation and function
      The connection between ORMDL3, sphingolipid metabolism, and disease is complex and context-dependent, with different consequences observed in different cell types and disease models.

How can single base editing techniques be applied to study ORMDL3 SNPs associated with asthma?

Single base editing provides a powerful approach to investigate the functional significance of ORMDL3-associated SNPs:
Methodology for ORMDL3 SNP Editing:

  • The C risk allele of SNP rs12603332 on chromosome 17q21 can be precisely edited to the T non-risk allele using Cytosine Base Editor (CBE) technology

  • This approach uses:

    • Catalytically impaired CRISPR-associated nuclease [nCas9(D10A)] complexed with a guide RNA (gRNA) for sequence-specific targeting

    • Cytosine deaminase enzyme rAPOBEC1 fused to the complex for targeted C-U conversion

    • Two tandem Uracil glycosylase inhibitor (UGI) units to inhibit Uracil-DNA glycosylase (UNG)
      Mechanism of Base Editing:

  • The rAPOBEC1 component changes the rs12603332 C allele to U

  • The nCas9 nicks the opposite strand to bias DNA repair

  • UGI "protects" the U by inhibiting UNG

  • This ultimately changes a C:G base pair to T:A following DNA replication
    Applications in Different Cell Types:

  • This approach has been successfully applied in human T cells (Jurkat and primary human CD4 cells)

  • Similar approaches could be extended to other relevant cell types such as airway smooth muscle cells, eosinophils, or epithelial cells
    Research Questions Addressable Through Base Editing:

  • Causal relationship between specific SNPs and ORMDL3 expression levels

  • Effects of risk alleles on downstream gene expression (e.g., ATF6α)

  • Cell type-specific consequences of SNP variants

  • Interaction with environmental triggers and their effect on cellular responses
    This technology allows researchers to create isogenic cell lines differing only in the SNP of interest, providing a powerful tool to establish causal relationships between genetic variation and functional outcomes.

How does ORMDL3 interact with the unfolded protein response (UPR) and ER stress pathways?

ORMDL3 has significant interactions with UPR and ER stress pathways:
ORMDL3 and UPR Pathway Activation:

  • ORMDL3 overexpression in mice (hORMDL3 zp3-Cre) leads to selective activation of the Activating Transcription Factor 6 (ATF6) UPR pathway

  • Notably, this occurs without activation of the other two UPR branches (Ire1 or PERK)

  • The ATF6 target gene SERCA2b, implicated in airway remodeling in asthma, is strongly induced in the lungs of hORMDL3 zp3-Cre mice
    ORMDL3 and ER Calcium Regulation:

  • ORMDL3 regulates the sarcoendoplasmic reticulum calcium transport ATPase (SERCA) pump

  • ORMDL3 overexpression leads to:

    • Decreased calcium ion levels in the ER

    • Increased resting calcium levels in the cytosol

    • Decreased ER-mediated calcium signaling

  • These effects can be reversed by overexpressing SERCA
    UPR Activation and Functional Consequences:

  • ORMDL3 overexpression activates the UPR pathway

  • Conversely, ORMDL3 knockdown:

    • Increases calcium release from the ER

    • Diminishes UPR activation

  • This ER stress and UPR activation may contribute to:

    • Airway remodeling through increased expression of TGF-β1 and ADAM8

    • Immune dysregulation

    • Endogenous inflammatory responses
      Cell Type-Specific Effects:

  • In CD4+ T cells, ORMDL3-mediated alterations in ER calcium can affect:

    • T cell activation

    • Cytokine production

    • Differentiation into effector subsets

  • In airway smooth muscle, increased ORMDL3 expression leads to upregulation of contractile genes (Serca2b and Sm22)
    The interaction between ORMDL3, ER calcium regulation, and UPR activation provides a mechanistic link between genetic risk factors and pathological features of asthma and potentially other inflammatory diseases.

What are the apparent contradictions in ORMDL3 research findings and how might they be resolved?

Several notable contradictions exist in the ORMDL3 research literature that require careful consideration:
1. Contradictory Effects in Different Asthma Models:

  • Contradictory Finding: While ORMDL3 is linked to increased asthma risk, ORMDL3 overexpression reduced neutrophil infiltration in a model of severe neutrophilic asthma

  • Potential Resolution:

    • ORMDL3 may have different effects in different asthma endotypes (Th2-high vs. neutrophilic)

    • Cell type-specific expression may lead to different outcomes

    • ORMDL3's effects may depend on the specific inflammatory context and triggers
      2. Discrepancies in Transgenic Mouse Phenotypes:

  • Contradictory Finding: Studies of global Ormdl3 transgenic mice have yielded contradictory results - some show exacerbated allergen-induced asthma , while others report no exacerbation of allergen asthma models

  • Potential Resolution:

    • Differences in transgene expression levels

    • Variations in genetic backgrounds

    • Different allergen challenge protocols

    • Age and sex differences in experimental animals
      3. Complex Effects on Calcium Signaling:

  • Contradictory Finding: ORMDL3 decreases calcium in the ER but increases cytosolic calcium levels in some studies , yet other studies show increased calcium channel activity (Orai1) that would further increase cytosolic calcium

  • Potential Resolution:

    • Cell type-specific effects on calcium handling

    • Compensatory mechanisms in different cell types

    • Temporal differences in acute vs. chronic ORMDL3 expression
      4. Variable Metabolic Effects:

  • Contradictory Finding: While whole-body Ormdl3 knockout mice reportedly develop impaired thermogenesis and insulin resistance on HFD, β-cell-specific Ormdl3 knockout mice showed no metabolic phenotype

  • Potential Resolution:

    • Cell-autonomous vs. non-autonomous effects

    • Primary vs. secondary effects on metabolism

    • Differential tissue-specific functions of ORMDL3
      Methodological Approaches to Resolve Contradictions:

  • Use of tissue-specific and inducible expression/knockout models

  • Standardization of experimental conditions across laboratories

  • Direct comparison of different models in the same study

  • Consideration of genetic background effects

  • Investigation of species-specific differences in ORMDL3 function

  • Integration of in vitro mechanistic studies with in vivo physiological outcomes
    Understanding these contradictions and their potential resolutions is essential for accurate interpretation of ORMDL3 research and translation to human disease.

What is the emerging role of ORMDL3 in regulating type I interferon signaling and anti-tumor immunity?

Recent research has uncovered an unexpected role for ORMDL3 in modulating type I interferon (IFN) signaling and anti-tumor immunity:
Negative Regulation of Type I IFN Signaling:

  • ORMDL3 functions as a negative modulator of type I interferon signaling

  • The mechanism involves:

    • Interaction with MAVS (Mitochondrial Antiviral Signaling protein)

    • Direction of RIG-I (Retinoic Acid-Inducible Gene I) for proteasome-mediated degradation
      Molecular Interaction Partners:

  • Immunoprecipitation coupled with mass spectrometry (IP-MS) revealed that ORMDL3 binds to USP10 (Ubiquitin-Specific Protease 10)

  • USP10 normally:

    • Forms a complex with RIG-I

    • Stabilizes RIG-I by decreasing its K48-linked ubiquitination

  • ORMDL3 disrupts this interaction, thereby promoting RIG-I degradation
    Effects on Anti-tumor Immunity:

  • In subcutaneous syngeneic tumor models in C57BL/6 mice:

    • Inhibition of ORMDL3 enhances anti-tumor efficacy

    • This occurs through augmentation of cytotoxic CD8+ T cells

    • IFN production in the tumor microenvironment (TME) is increased
      Implications for Therapeutic Development:

  • ORMDL3 inhibition might represent a novel approach for enhancing anti-tumor immunity

  • Targeting the ORMDL3-USP10-RIG-I axis could potentially modulate both antiviral and anti-tumor immune responses

  • This pathway might also be relevant to understanding the complex relationship between asthma and cancer risk
    This emerging role of ORMDL3 in immune regulation extends beyond its established functions in sphingolipid metabolism and ER stress, highlighting the multifaceted nature of this protein in health and disease.

What are the best practices for working with recombinant mouse ORMDL3 protein in experimental systems?

When working with recombinant mouse ORMDL3 protein, researchers should consider these best practices:
Protein Expression and Purification:

  • Express recombinant mouse ORMDL3 with appropriate tags (His-tag or GST-tag) for purification and detection

  • Consider membrane protein-specific expression systems, as ORMDL3 is a transmembrane protein

  • For functional studies, verify that any fusion tags do not interfere with protein activity

  • Purify under conditions that maintain native conformation (avoid harsh detergents or denaturing conditions)
    Protein Characterization:

  • Verify protein identity by western blot (expected molecular weight ~17 kDa)

  • Confirm functionality through in vitro assays (e.g., SPT inhibition assay)

  • Assess protein folding and stability using biophysical techniques

  • For structural studies, optimize buffer conditions to maintain protein stability
    Experimental Applications:

  • For cell-based studies, optimize protein delivery methods:

    • Transfection of expression constructs

    • Protein transduction techniques for direct delivery

  • When overexpressing ORMDL3, consider physiologically relevant expression levels

  • In functional assays, include appropriate controls:

    • Inactive ORMDL3 mutants

    • Related family members (ORMDL1, ORMDL2)

    • Species-matched controls when comparing human and mouse ORMDL3
      Storage and Handling:

  • Store purified protein at appropriate temperature (typically -80°C)

  • Avoid repeated freeze-thaw cycles

  • Prepare single-use aliquots when possible

  • Include stabilizing agents if necessary for long-term storage
    By following these practices, researchers can ensure reliable and reproducible results when working with recombinant mouse ORMDL3 protein.

How can researchers reconcile in vitro findings with in vivo observations in ORMDL3 research?

Reconciling in vitro and in vivo findings presents challenges in ORMDL3 research:
Common Discrepancies:

  • Cell culture studies may show direct effects of ORMDL3 on cellular functions, while in vivo models reveal more complex, sometimes contradictory outcomes

  • Overexpression systems may demonstrate phenotypes not observed in physiological contexts

  • In vitro studies may miss compensatory mechanisms present in vivo

  • Acute manipulations in vitro might differ from chronic alterations in transgenic models
    Strategies for Reconciliation:

  • Physiologically Relevant Models:

    • Use primary cells rather than transformed cell lines when possible

    • Develop co-culture systems that recapitulate tissue interactions

    • Consider 3D culture systems or organoids for airway or immune studies

    • Adjust protein expression to physiologically relevant levels

  • Temporal Considerations:

    • Compare acute vs. chronic ORMDL3 manipulations

    • Use inducible expression systems to control timing

    • Monitor adaptive responses over time

    • Consider developmental effects in transgenic models

  • Context-Dependent Effects:

    • Study ORMDL3 under both basal and stimulated conditions

    • Include relevant microenvironmental factors (cytokines, growth factors)

    • Assess cell type-specific responses

    • Consider system-wide compensatory mechanisms

  • Translational Approaches:

    • Validate key in vitro findings in multiple in vivo models

    • Use tissue-specific conditional models to isolate cell-autonomous effects

    • Compare findings across species (mouse vs. human)

    • Correlate with human genetic and clinical data By integrating multiple experimental approaches and carefully considering the limitations of each system, researchers can develop more comprehensive models of ORMDL3 function that reconcile in vitro mechanistic insights with in vivo physiological relevance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.