Recombinant Mouse Outcome predictor in acute leukemia 1 homolog (Opal1)

Shipped with Ice Packs

In Stock

Cat. No.

BT2502529

Source

in vitro E.coli expression system

Synonyms

Wbp1l; D19Wsu162e; Opal1; WW domain binding protein 1-like; Outcome predictor in acute leukemia 1 homolog

Quick Inquiry

Description

2.1. Generation and Validation

Recombinant mouse Opal1 is produced via transfection in mammalian systems (e.g., HEK-293 cells) for functional assays. Key validation steps include:

Flow Cytometry: Anti-OPAL1 monoclonal antibodies (e.g., OPAL1-01) enable intracellular detection .
Western Blot: Specific antibodies confirm protein identity and purity .

2.2. Knockout Mouse Studies

Wbp1l<sup>−/−</sup> mice reveal critical roles in hematopoiesis and immune cell regulation:

Phenotypic Feature	Wbp1l<sup>−/−</sup> vs. Wild-Type	Citation
Splenic Marginal Zone B Cells	Increased frequency
Peritoneal B1 Cells	Reduced frequency
Splenic Dendritic Cells	Increased frequency
Bone Marrow Hematopoiesis	Impaired CXCR4 signaling

These findings suggest Opal1 regulates CXCR4-mediated bone marrow homing and lymphoid subset homeostasis .

3.1. Signaling Pathways

CXCR4 Regulation: Opal1 deficiency disrupts CXCR4 signaling, critical for hematopoietic stem cell retention in bone marrow .
Drug Resistance: Low OPAL1 expression in human ALL does not correlate with resistance to prednisolone, vincristine, or daunorubicin .

3.2. Prognostic Relevance

While mouse studies focus on mechanistic roles, human data show:

High OPAL1 mRNA associates with TEL-AML1 fusion (2.8-fold increase) and favorable outcomes in pediatric ALL .
No independent prognostic value in multivariate analyses across COALL and St Jude cohorts .

4.1. Antibody Development

OPAL1-01 (PE-conjugated): Used for intracellular flow cytometry in human and mouse cells .
Epitope: Targets the C-terminal region (amino acids 150–end) .

4.2. Experimental Protocols

Transfection Models: HEK-293 cells transfected with OPAL1 serve to study protein localization and interactions .
Knockout Strategies: Wbp1l<sup>−/−</sup> mice employ Cre-LoxP and FLP-FRT systems for conditional deletion .

Unresolved Questions and Future Directions

Mechanistic Role: The exact molecular function of Opal1 in mitochondrial or signaling pathways remains unclear .
Therapeutic Potential: Whether modulating Opal1 expression influences leukemia progression or treatment resistance warrants investigation .

Product Specs

Form

Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your requirements.

Lead Time

Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Please contact us in advance for dry ice shipping; additional fees will apply.

Notes

Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.

Reconstitution

Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.

Shelf Life

Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.

Storage Condition

Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.

Tag Info

Tag type is determined during the manufacturing process.

Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.

Synonyms

Wbp1l; D19Wsu162e; Opal1; WW domain binding protein 1-like; Outcome predictor in acute leukemia 1 homolog

Buffer Before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Datasheet

Please contact us to get it.

Expression Region

1-348

Protein Length

full length protein

Species

Mus musculus (Mouse)

Target Names

Wbp1l

Target Protein Sequence

MPFLWGLRQDKEACVGTNNQSYICDTGHCCGQSQCCNYYYELWWFWLVWTVVIILSCCCV CHHRRAKHRLQAQQRQHEINLIAYREAHNYSALPFYFRFLPNSLLPPYEEVVNRPPTPPP PYSAFQLQQQQQLLPPPPQGGPPGGSPPGADPPPQGSQGAQSSPLSGPSRSSTRPPSVAD PQSPEVPTDREATKASGTESGSPMAGHGELDPGAFLDQDSECKEELLKDSRSERGGVSPD SEDKTPGRHRRFTGDSGIEVCVCNRGHHDDDLKEFNTLIDDALDGPLDFCDSCHVRPPVD EEEGLCLSSEGQAREHGHPHLPRPPACLLLNTINEQDSPNSQHSGSPS

Uniprot No.

Q8BGW2

Target Background

Database Links

KEGG: mmu:226178

UniGene: Mm.329895

Subcellular Location

Membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Source

Quantity&Size*

Product Name

Message

Recombinant Mouse Outcome predictor in acute leukemia 1 homolog (Opal1)

Description

2.1. Generation and Validation

2.2. Knockout Mouse Studies

3.1. Signaling Pathways

3.2. Prognostic Relevance

4.1. Antibody Development

4.2. Experimental Protocols

Unresolved Questions and Future Directions

Product Specs

Target Background

Quick Inquiry

Category

Service