Recombinant Mouse Outer dense fiber protein 4 (Odf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is dependent on various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development if possible.
Synonyms
Odf4; Oppo1; Outer dense fiber protein 4; Outer dense fiber of sperm tails protein 4; Testis-specific protein oppo 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Odf4
Target Protein Sequence
MEPDLNEEESERIRTSRNRRSLEHRRNSLLPFQWKATNNSRWMAQVVASEFSLVAFLLLL VMVFSKKWLYPSKSRFHQRYPQNVTKRVYTSIHSMSTGLLYICVSKSCPSSDNGEDNFKM WTIHPVFGVAKISFTLAIGLGFVLTTWLHLPYLPCLQRMPFFGLIGIILSFCEVTLIFLT LLLFPVNLWIYELRKNISVPIGWSYFIGWLVLILYFTCGILCYLNHKNYWSLIMSSTTIN TACSSLGPESLVSPSQTPSSQENSQESPKDDQKPSSPDKVVSPPQPDTTG
Uniprot No.

Target Background

Function
Outer dense fiber protein 4 (Odf4) is a component of the outer dense fibers (ODF) of spermatozoa. It is believed to be involved in sperm tail structure, sperm movement, and general organization of the cellular cytoskeleton.
Gene References Into Functions
  1. Odf4 plays a significant role in sperm tail structure and/or sperm movement. PMID: 12079992
Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in testis.

Q&A

What is the structural composition of mouse Odf4 and how does it compare to other ODF proteins?

Mouse Odf4 belongs to the family of outer dense fiber proteins that form critical cytoskeletal structures in sperm flagella. Similar to other ODF proteins like Odf2, it likely contains structural motifs that enable protein-protein interactions vital for flagellar architecture. Odf2, a well-characterized family member, contains two leucine zipper motifs that facilitate interactions with other proteins, including Odf1 . While specific Odf4 structural data is still emerging, comparative analysis with Odf2 suggests potential shared structural features that enable integration into the dense fiber network surrounding microtubule doublets in the axoneme.

How is Odf4 expression regulated during spermatogenesis?

Based on studies of related ODF proteins, Odf4 expression likely follows a developmental pattern similar to Odf2, with expression beginning in pachytene spermatocytes and peaking in round spermatids . Researchers can investigate Odf4 expression using RT-qPCR and western blotting across postnatal developmental timepoints (P7, P14, P21, P28, P35, and P56), which correspond to different stages of spermatogenesis. Cell separation techniques like STA-PUT velocity sedimentation can isolate specific germ cell populations to precisely determine the stage-specific expression pattern .

What methods are most effective for producing recombinant mouse Odf4 protein?

For producing recombinant mouse Odf4:

  • Expression system selection: E. coli BL21(DE3) is commonly used for initial attempts, though mammalian expression systems (HEK293 or CHO cells) may provide better folding and post-translational modifications.

  • Construct design: Include a fusion tag (His, GST, or MBP) to facilitate purification and detection. For functional studies, consider removable tags using TEV or thrombin protease sites.

  • Solubility enhancement: Optimize expression conditions (temperature, IPTG concentration, induction time) or use solubility-enhancing fusion partners if insolubility issues arise.

  • Purification protocol: Implement a two-step purification strategy using affinity chromatography followed by size exclusion chromatography to achieve high purity.

Validation of recombinant protein can follow approaches used for Odf2, where antibody specificity was confirmed using GST-fusion proteins .

What are the recommended approaches for generating Odf4 knockout mouse models?

Based on successful approaches with related proteins, researchers can consider:

  • CRISPR-Cas9 gene editing: Design guide RNAs targeting early exons to create frameshift mutations. This approach was successfully used for TMEM232, where a 9297-bp fragment was deleted .

  • Conditional knockout strategies: For tissue-specific or temporal control, implement Cre-lox or FLP-FRT systems. The Cre-lox system enables tissue-specific gene deletion by flanking essential Odf4 exons with loxP sites .

  • Gene trap approaches: Similar to the XL169 ES cell line used for Odf4 studies, gene trap insertions can create fusion proteins with reporters like β-geo, allowing tracking of gene expression while disrupting function .

  • Validation methods: Confirm knockout through RT-PCR, western blotting, and sequencing of the targeted locus, as demonstrated in TMEM232 studies .

How can interactions between Odf4 and other flagellar proteins be effectively studied?

To investigate protein-protein interactions involving Odf4:

  • Co-immunoprecipitation (Co-IP): Use antibodies against Odf4 to pull down protein complexes from testis lysates, followed by mass spectrometry to identify binding partners. This approach successfully identified TMEM232 interactions with septins and ATAT1 .

  • Yeast two-hybrid screening: Employ Odf4 as bait to screen testis cDNA libraries for potential interactors.

  • Proximity labeling techniques: BioID or APEX2 fusion proteins can identify proteins in close proximity to Odf4 in cellular contexts.

  • GST pull-down assays: For confirming direct interactions between recombinant Odf4 and candidate partners.

  • Immunofluorescence co-localization: Visualize spatial relationships between Odf4 and potential partners in sperm sections.

Studies of Odf2 revealed its interaction with Odf1 through leucine zipper motifs and with cdk5, which can phosphorylate Odf1 , suggesting similar approaches could be productive for Odf4.

What phenotypes should be examined in Odf4-deficient mice to assess impact on fertility?

Comprehensive phenotyping of Odf4-deficient mice should include:

  • Fertility assessment: Breeding trials with wild-type females to quantify litter size and frequency.

  • Sperm count and morphology: Evaluation of sperm from caudal epididymis using light and electron microscopy to detect structural abnormalities.

  • Sperm motility analysis: Computer-assisted sperm analysis (CASA) to quantify movement parameters.

  • Ultrastructural analysis: Transmission electron microscopy to examine flagellar structure, focusing on:

    • Integrity of the 9+2 axonemal arrangement

    • Outer dense fiber organization

    • Mitochondrial sheath formation

    • Annulus structure at the midpiece-principal piece junction

  • Molecular analysis: Proteomics to identify changes in expression of other flagellar proteins.

TMEM232 knockout studies revealed infertility in male mice with specific defects including reduced sperm count, immotility, and ultrastructural abnormalities such as missing outer microtubule doublets .

How does Odf4 phosphorylation influence sperm motility and function?

Based on findings with related proteins:

Tyrosine phosphorylation of ODF proteins appears crucial for sperm motility regulation. Studies with Odf2 demonstrated that inhibition of tyrosine phosphorylation adversely impacts sperm motility . For Odf4, researchers should:

  • Identify phosphorylation sites: Use mass spectrometry to map specific residues susceptible to phosphorylation.

  • Create phosphomimetic and phosphodeficient mutants: Generate recombinant Odf4 with mutations at key phosphorylation sites (e.g., Y→E to mimic phosphorylation, Y→F to prevent it).

  • Investigate kinases: Identify kinases responsible for Odf4 phosphorylation, potentially including cdk5 which has been shown to interact with Odf2 .

  • Assess functional impact: Analyze how phosphorylation affects protein-protein interactions and structural integrity of the flagellum.

What proteomics approaches best characterize changes in flagellar composition in Odf4-mutant mice?

For comprehensive proteomic analysis of Odf4-deficient sperm:

  • Sample preparation: Isolate sperm from caudal epididymis with protease and phosphatase inhibitors to preserve post-translational modifications.

  • Quantitative proteomics: Implement label-free quantification or TMT/iTRAQ labeling to compare protein abundance between wild-type and Odf4-mutant sperm.

  • Data analysis pipeline:

    • Principal component analysis to assess sample clustering

    • Volcano plot visualization to identify differentially expressed proteins

    • Pathway enrichment analysis to determine affected biological processes

  • Validation: Confirm key findings with western blotting for selected proteins.

This approach successfully identified 343 differentially expressed proteins in TMEM232-knockout sperm, revealing downregulation of cytoskeletal components and metabolic enzymes .

How do different genetic backgrounds influence the phenotype of Odf4-mutant mice?

The impact of genetic background on Odf4-related phenotypes can be investigated by:

  • Backcrossing strategy: Transfer the mutation to different inbred strains (C57BL/6J, 129S1/SvImJ, FVB/NJ) through at least 10 generations of backcrossing.

  • Mixed background analysis: Analyze phenotypes in early backcross generations (F2, N2) to detect modifier loci.

  • Quantitative trait locus (QTL) mapping: Identify genomic regions that modify the severity of Odf4-related phenotypes.

  • Phenotypic parameters to monitor:

    • Fertility metrics (litter size, time to pregnancy)

    • Sperm parameters (count, morphology, motility)

    • Ultrastructural integrity of flagella

What is the relationship between Odf4 and other outer dense fiber proteins in flagellar assembly?

To determine the hierarchical relationship and functional interdependence between Odf4 and other ODF proteins:

  • Sequential immunofluorescence analysis: Examine the temporal appearance of ODF proteins during spermiogenesis.

  • Cross-examination of knockout models: Analyze expression and localization of other ODF proteins in Odf4-deficient mice and vice versa.

  • Domain mapping: Identify which domains of Odf4 are required for interaction with other ODF proteins.

  • In vitro assembly studies: Reconstitute ODF formation using purified recombinant proteins to determine assembly order.

Studies of TMEM232 revealed its requirement for proper expression and localization of septins in the annulus , suggesting similar approaches could elucidate Odf4's role in the ODF protein network.

What are the best approaches for generating specific antibodies against mouse Odf4?

To generate high-quality Odf4 antibodies:

  • Antigen design options:

    • Full-length recombinant protein for polyclonal antibodies

    • Specific peptides (15-20 amino acids) from unique regions for epitope-specific antibodies

    • Domains predicted to be exposed in the native protein

  • Validation strategy:

    • Western blotting against testis lysates from wild-type and Odf4-knockout mice

    • Immunoprecipitation followed by mass spectrometry

    • Immunofluorescence with appropriate controls

    • Preabsorption tests with immunizing antigen

  • Cross-reactivity assessment: Test against recombinant proteins of related ODF family members.

For TMEM232 studies, researchers successfully generated antibodies against a specific epitope (302-381 aa) and validated them using GST-fusion proteins .

How can researchers optimize immunolocalization of Odf4 in sperm and testicular sections?

For optimal Odf4 immunolocalization:

Tissue Preparation MethodFixationAntigen RetrievalBlockingRecommended Applications
Paraffin sections4% PFA, 24hCitrate buffer pH 6.0, 95°C, 20 min5% BSA, 0.3% Triton X-100Developmental studies, tissue architecture
Frozen sections4% PFA, 2hNo retrieval needed5% normal goat serumPreservation of sensitive epitopes
Isolated sperm2% PFA, 15 minMethanol, -20°C, 5 min3% BSADetailed subcellular localization
Isolated spermatogenic cells2% PFA, 10 min0.1% Triton X-100, 10 min3% BSAStage-specific expression

Additional considerations:

  • Use specialized detergents (0.1% SDS or 0.5% sodium deoxycholate) for exposing epitopes in highly compact sperm structures

  • Include tyrosine phosphatase inhibitors if studying phosphorylated forms

  • Consider dual immunofluorescence with established flagellar markers (acetylated tubulin, Odf2) for precise localization

How conserved is Odf4 structure and function across mammalian species?

Evolutionary conservation analysis of Odf4 should examine:

  • Sequence homology: Compare mouse Odf4 amino acid sequences with orthologs from human, non-human primates, and other mammals. For context, human TMEM232 shares 65.49% protein sequence identity with its mouse ortholog, and much higher conservation with other primates (99.09% with macaques) .

  • Domain conservation: Identify which domains show highest conservation, suggesting functional importance.

  • Species-specific adaptations: Detect positive selection signatures in specific lineages that might reflect adaptation to different reproductive strategies.

  • Expression pattern conservation: Compare developmental timing and cell-type specificity of expression across species.

  • Functional conservation: Test whether human Odf4 can rescue phenotypes in mouse Odf4-knockout models.

What bioinformatics resources and tools are most useful for studying Odf4 protein structure and function?

Recommended bioinformatics resources include:

  • Sequence and structure prediction:

    • UniProt (https://www.uniprot.org/) for protein annotation and domain prediction

    • PSIPRED for secondary structure prediction

    • AlphaFold for 3D structure prediction

    • SWISS-MODEL for homology modeling

  • Evolutionary analysis:

    • Ensembl (http://asia.ensembl.org/) for ortholog identification

    • PAML for detecting selection signatures

    • ConSurf for mapping conservation onto protein structures

  • Functional prediction:

    • Eukaryotic Linear Motif resource for identifying functional motifs

    • NetPhos for phosphorylation site prediction

    • GPS for kinase-specific phosphorylation prediction

  • Visualization tools:

    • PyMOL or UCSF Chimera for structural visualization

    • Jalview for multiple sequence alignment visualization

These tools can be applied as demonstrated in TMEM232 studies, which used Ensembl for ortholog identification and UniProt for structural feature prediction .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.