Recombinant Mouse Oxytocin receptor (Oxtr)

Shipped with Ice Packs
In Stock

Description

Applications in Research

Recombinant Oxtr is pivotal for studying oxytocin signaling pathways and their roles in neurobiology and physiology:

  • Circuit Mapping: Utilized in knock-in mouse models (e.g., Oxtr-iCre and Oxtr-Cre-ERT2) to visualize and manipulate Oxtr-expressing neurons via viral vectors .

  • Behavioral Studies: Linked to social recognition, aggression, and maternal behavior in Oxtr knockout mice .

  • Structural Analysis: Epitope-tagged versions enable super-resolution imaging of Oxtr distribution on neural membranes .

  • Pharmacological Assays: Measures ligand-binding kinetics (e.g., OXT–OXTR dissociation constants range: 0.56–9.32 nM) .

Social and Behavioral Modulation

  • Oxtr knockout mice exhibit pervasive social deficits, including reduced ultrasonic vocalizations and elevated aggression .

  • Activation of Oxtr-expressing neurons in the lateral septum ameliorates autism-like social novelty deficits in mouse models .

Epigenetic Regulation

  • DNA methylation of CpG islands in the Oxtr promoter suppresses receptor expression, impacting stress responses and social memory .

  • Tet1-deficient mice show hypermethylation of Oxtr, leading to reduced oxytocin signaling .

Comparative Analysis with Native and Engineered Models

ModelAdvantagesLimitations
Native OxtrEndogenous expression profilesLow abundance in neural tissues
Oxtr-Venus Knock-In Fluorescent visualizationDevelopmental decline in reporter expression
Oxtr-iCre Cre-dependent neural circuit mappingRequires viral vector delivery
Oxtr-Cre-ERT2 Spatiotemporal control via tamoxifenVariable recombination efficiency

Recent Advances and Therapeutic Potential

  • Binding Dynamics Modeling: Predicts optimal oxytocin dosing for labor induction while minimizing uterine hyperstimulation risks .

  • Variant-Specific Signaling: Mutants like V281M and E339K show impaired OXT–OXTR complex formation, suggesting personalized therapeutic strategies .

  • Super-Resolution Imaging: Epitope-tagged Oxtr enables 3D visualization of receptor clusters on neuronal membranes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Oxtr; Oxytocin receptor; OT-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-388
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MEGTPAANWSIELDLGSGVPPGAEGNLTAGPPRRNEALARVEVAVLCLILFLALSGNACV LLALRTTRHKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV VGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLATWLGCLVASVPQVHIFSLREV ADGVFDCWAVFIQPWGPKAYVTWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAA AAEGSDAAGGAGRAALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVWD VNAPKEASAFIIAMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSARYLKGSRPGETS ISKKSNSSTFVLSRCSSSQRSCSQPSSA
Uniprot No.

Target Background

Function
The oxytocin receptor (Oxtr) is a G protein-coupled receptor that mediates oxytocin signaling. Activation of Oxtr initiates a phosphatidylinositol-calcium second messenger system.
Gene References Into Functions

Functional Studies of the Oxytocin Receptor (Oxtr):

  1. Repression of OXTR signaling acutely modulates social interaction and sensory response profiles. PMID: 29231812
  2. OTR activation may contribute to restoring sexual olfactory preferences in sexually naive Tph2-/- female mice. PMID: 29470551
  3. Depressive-like behavior alters oxytocin receptor (OxtR) and arginine vasopressin receptor type 1a (AvpR1a) gene expression in the male mouse hippocampus. PMID: 27525673
  4. Chemogenetic activation of Oxtr neurons in the parabrachial nucleus robustly suppressed non-caloric fluid intake but did not affect food intake after fasting or salt intake. PMID: 29184212
  5. Binding activity of OXTR in neonatal mice. PMID: 28235051
  6. OXTR is an acute-phase protein whose increased expression, regulated by NF-kappaB, attenuates cellular inflammatory responses in macrophages. PMID: 28049625
  7. The oxytocin system regulates ethanol drinking and sensitivity, with OxtR as a key mediator. OxtR manipulation may be a strategy for addressing ethanol use disorders. PMID: 27306084
  8. This research contributes to the monosynaptic analysis of neuronal circuits and optogenetic analysis of oxytocin receptor-expressing neurons. PMID: 26442453
  9. Microglial abnormality may be a mechanism underlying Oxt/Oxtr-mediated autism spectrum disorder-like phenotypes. PMID: 26926566
  10. The oxytocin receptor is necessary for conditioned effects of an ethanol-associated social stimulus. PMID: 26282397
  11. Lateral septal mGluR5 and Oxtr play specialized roles in regulating discrete social behaviors, and deficits in these receptors may contribute to impaired social interaction. PMID: 25824423
  12. OTR-null mice exhibit increased aggression towards same-strain intruders compared to wild-type or heterozygous mice. PMID: 24929102
  13. Raphe serotonin neuron-specific oxytocin receptor knockout reduces aggression without affecting anxiety-like behavior. PMID: 25677455
  14. Oxtr signaling is crucial for associating odors with social cues but is not essential for associating odors with non-social cues. Oxytocin enhances the salience of social stimuli during odor-driven social learning in the piriform cortex. PMID: 26139372
  15. This study investigated the role of OxtR in the acquisition, extinction, and reinstatement of ethanol-induced conditioned place preference using the oxytocin analog carbetocin and nucleus accumbens viral-mediated overexpression. PMID: 25449413
  16. Oxytocin's effect on osteoblast differentiation depends on Oxtr internalization and nuclear translocation, facilitated by interactions with beta-arrestins, Rab5, Kpnb1, and Tnpo1. PMID: 25378700
  17. Silencing of oxytocin receptor-expressing interneurons in the medial prefrontal cortex of female mice reduces social interest in male mice specifically during estrus. PMID: 25303526
  18. Impairments in the initiation of maternal behavior are observed in oxytocin receptor knockout mice. PMID: 24892749
  19. Oxytocin elicits satiety through both central and peripheral oxytocin receptors. PMID: 24877632
  20. Mouse Oxtr gene expression is epigenetically regulated by DNA methylation of its promoter. PMID: 24275011
  21. Early interactions with mother and peers independently influence adult social skills and brain levels of BDNF and the oxytocin receptor. PMID: 22910688
  22. The central oxytocin/oxytocin receptor system plays a role in regulating body temperature homeostasis. PMID: 24002032
  23. Septal oxytocin receptors enhance fear responses. PMID: 23872596
  24. The Oxtr(+/-) mouse model is useful for studying how partial loss of the Oxtr gene impairs social interactions. PMID: 22967062
  25. LPS increases COX-2, connexin 43, and oxytocin receptor expression in the uterus. PMID: 22676250
  26. Male aggression is heightened in oxytocin receptor-deficient mice, potentially due to differential activation in the medial amygdala and lateral septum. PMID: 22609339
  27. The Oxtr KO mouse model exhibits social deficits and reduced communication, resembling aspects of autism spectrum disorders. PMID: 22100185
  28. Review of experience effects on oxytocin receptor binding. PMID: 22245313
  29. Evidence for the role of OTR in predicting maternal behavior in mice. PMID: 22300676
  30. Mice with forebrain-specific Oxt receptor loss post-weaning show reduced freezing behavior during fear conditioning and retention. PMID: 21668734
  31. Variations in estrogen alpha/beta receptor levels affect social interaction via the OT and AVP systems by upregulating gene expression for these peptides and their receptors. PMID: 21749489
  32. Oxytocin and oxytocin receptors are involved in the regulation of ghrelin secretion. PMID: 21521750
  33. Beta-arrestin mediates desensitization of the OXTR, reducing uterine contractility. PMID: 21139074
  34. Inflammatory cytokines modulate functional oxytocin receptor expression in airway smooth muscle. PMID: 20670427
  35. In mast cells, ovarian hormones modulate OTR expression, and oxytocin's effect on 5HT uptake is mediated by OTRs and protein kinase C. PMID: 12374464
  36. Increased myometrial oxytocin receptor and estrogen receptor alpha expression in late pregnant relaxin+/+ mice is attenuated in relaxin-/- mice, possibly via estrogen receptor-alpha activation. PMID: 12959965
  37. Novel sites of oxytocin receptor expression in the mouse brain suggest additional oxytocinergic system functions. PMID: 14596857
  38. Oxytocin-induced uterine contraction is not solely regulated by the quantity of OT receptors in the non-pregnant mouse uterus. PMID: 15358162
  39. Myometrial OTRs are significantly decreased on gestation day 18.5 in relaxin (Rlx)-/- mice compared to Rlx+/+ mice. PMID: 15956692
  40. OXTR plays a critical role in regulating social behavior, including male aggression and maternal nurturing. PMID: 16249339
  41. Oxytocin receptor-deficient mice develop late-onset obesity. PMID: 18520999
  42. Social recognition studies in oxytocin receptor-containing and knockout mice. PMID: 18655873
  43. ORE-deficient mice exhibit aberrations in social behaviors, including male aggression and mother-offspring interaction. PMID: 18655874
  44. Oxytocin may regulate serotonin release and exert anxiolytic effects via direct activation of oxytocin receptors in raphe nuclei serotonergic neurons. PMID: 19228979
  45. The Oxtr may be involved in 'fine' intrastrain recognition but is less important in 'broad' interstrain recognition. PMID: 19531157
Database Links
Protein Families
G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic structure of the mouse Oxtr gene?

The mouse Oxytocin receptor gene consists of four exons and three introns, with multiple potential transcript variants. Recent research has identified several transcriptional variants with unique 5' transcription start sites. The conventional transcript (Oxtr-A) contains all four exons and three introns, while other variants like Oxtr-B consist of a 5' extended exon 3 spliced to exon 4. Additional variants have been characterized in both brain and uterine tissue, potentially encoding proteins with different functional properties . When designing your experimental approach, consider which transcript variant(s) may be relevant to your specific research question, as targeting only the canonical transcript may yield incomplete results.

How do researchers generate Oxtr knockout mouse models?

Researchers typically use two approaches for Oxtr knockout generation: conventional knockout and conditional knockout models. Conventional knockouts may be generated by crossing Oxtr flox mice or by injecting Cre mRNA into Oxtr zygotes . For conditional knockouts, researchers use the Cre-loxP system, often employing a flox/null model to increase the efficiency of conditional knockout. The flox/null approach is preferred when high Oxtr gene expression levels could result in small fractions of the flox alleles escaping recombination, which would mask phenotypes. For Oxtr conditional knockout, the flox/flox model is often chosen because haploinsufficiency effects of Oxtr have been reported, at least in social behavior contexts .

What are the available mouse lines for studying Oxtr expression and function?

Several genetically engineered mouse lines have been developed for Oxtr research:

Mouse LineModificationResearch ApplicationsNotable Features
Oxtr flox/floxFloxed Oxtr allelesConditional knockout studiesEnables tissue-specific deletion when crossed with Cre lines
Oxtr-VenusVenus reporter replacing first coding exonReceptor visualizationExpression decreases during development due to lack of regulatory elements
Oxtr-PA-tdTomPA tag and tdTomato reporterCell labeling and visualizationPreserves endogenous transcriptional regulation
Oxtr-HA-iCreHA tag and iCre recombinaseCre-dependent manipulationsAllows viral vector-dependent functional analysis
Oxtr-HA-iCreERT2HA tag and tamoxifen-inducible CreTemporally controlled recombinationEnables developmental stage-specific studies

The newer knock-in lines preserve endogenous transcriptional regulations and are generally more reliable for visualizing true Oxtr expression patterns . When selecting a model, consider whether temporal control of recombination is needed for your experimental design.

How can I visualize Oxtr protein distribution in the brain?

Visualizing native Oxtr protein has been challenging due to antibody specificity issues. A significant advancement has been the development of epitope-tagged Oxtr knock-in mouse lines. The PA-tagged and HA-tagged Oxtr mouse lines allow super-resolution imaging to visualize Oxtr protein distribution on neural membranes with high specificity . These lines enable three-dimensional mapping of receptor localization that was previously impossible. For visualization, perfuse mice with 4% paraformaldehyde, section the brain at 40-50 μm, and perform immunohistochemistry using antibodies against the specific tag (PA or HA). Super-resolution microscopy techniques like STED or STORM can then be used to examine subcellular localization of the receptor .

What are the advantages of using T2A self-cleaving peptide sequences in Oxtr reporter mice?

The T2A self-cleaving peptide technology allows researchers to maintain endogenous Oxtr expression while simultaneously expressing a reporter protein from the same transcript. This approach ensures that reporter expression accurately reflects endogenous Oxtr expression patterns. In the Oxtr-PA-tdTom line, the T2A peptide enables cleavage between the Oxtr-PA tag fusion protein and the tdTomato reporter, resulting in separate proteins translated from a single mRNA transcript . This strategy preserves normal Oxtr function while allowing visualization of Oxtr-expressing cells. Electrophysiological recordings from tdTomato-positive cells have validated the fidelity of this approach, confirming that the reporter accurately marks cells with functional Oxtr expression .

How do I distinguish between different Oxtr transcript variants in my experiments?

To distinguish between Oxtr transcript variants, design transcript-specific primers that span unique exon junctions or include unique 5' regions. The 5' Rapid Amplification of cDNA Ends (5' RACE) technique has been successfully used to identify distinct Oxtr transcripts in both brain and peripheral tissues . For quantitative analysis, develop transcript-specific qPCR assays targeting unique regions of each variant. Validation of transcript-specific primers is essential, preferably using known positive controls for each variant. Consider that different transcripts may be differentially regulated across tissues and developmental stages, so comparing expression patterns across multiple regions and timepoints may provide valuable insights into transcript-specific functions .

What are the implications of Oxtr alternative transcripts for knockout mouse phenotype interpretation?

The presence of multiple Oxtr transcripts significantly complicates the interpretation of knockout mouse phenotypes. Conventional knockout strategies may not target all transcript variants, potentially leaving functional receptor expression intact from alternative transcripts. For example, if a knockout strategy targets the first exon (as in the Oxtr-Venus mouse), transcripts that initiate downstream of this region might still be expressed . This could explain seemingly contradictory findings in different knockout models. When designing new knockout models or interpreting existing data, carefully evaluate which transcripts are affected by the genetic modification. Consider using RNA-seq or transcript-specific qPCR to verify the absence of all relevant Oxtr transcripts in your knockout model .

How does DNA methylation affect Oxtr expression and function?

DNA methylation in the Oxtr promoter region plays a crucial role in regulating transcript-specific expression. Research indicates that different Oxtr transcripts may be under unique epigenetic regulation, with only specific alternative transcripts showing association with DNA methylation in the promoter during the perinatal period . These epigenetic patterns can be altered by environmental factors, including maternal oxytocin administration, which has been shown to modify the expression of specific Oxtr transcripts in offspring . To investigate epigenetic regulation, consider bisulfite sequencing of the Oxtr promoter regions associated with different transcript start sites. Correlate methylation patterns with transcript-specific expression data to determine how epigenetic modifications influence the transcriptional landscape of Oxtr in your experimental context.

How can I study Oxtr function in specific brain regions?

To study region-specific Oxtr function, several complementary approaches are available:

  • Conditional knockout: Use Oxtr-floxed mice with region-specific Cre driver lines or stereotaxic injection of AAV-Cre into the target region of Oxtr flox/flox or Oxtr flox/null mice .

  • Viral vector-mediated manipulation: The Oxtr-HA-iCre mouse line enables region-specific Cre-dependent manipulations through stereotaxic delivery of floxed viral constructs. Retro-orbital injections of AAV-PHP.eB vector into this Cre line have successfully enabled visualization of recombinase activities in appropriate brain regions .

  • Temporally controlled manipulation: The Oxtr-HA-iCreERT2 line allows for tamoxifen-inducible Cre-mediated recombination, enabling temporal control of gene manipulation in Oxtr-expressing neurons .

  • Electrophysiological recording: Use the Oxtr-PA-tdTom reporter line to identify and record from Oxtr-expressing neurons. Patch-clamp recordings from tdTomato-positive cells can assess functional responses to oxytocin or other relevant stimuli .

For all approaches, include appropriate controls to account for potential off-target effects of viral vectors or drug treatments.

What are the best methods to study the role of Oxtr in feeding behavior and obesity?

To investigate Oxtr's role in feeding behavior and obesity, consider these methodological approaches:

  • Conditional knockout in feeding-related nuclei: Target the posterior hypothalamus or specific hypothalamic nuclei like the paraventricular nucleus using stereotaxic injection of AAV-Cre into Oxtr flox/null mice. This approach has revealed that oxytocin secretion from the paraventricular hypothalamic nucleus suppresses hyperphagic obesity .

  • Metabolic phenotyping: Measure food intake using automated feeding monitoring systems to capture meal patterns, food preference, and circadian variations in feeding. Body composition analysis using DEXA or MRI provides more detailed information than simple body weight measurements .

  • Diet challenges: Expose mice to high-fat diets or food choice paradigms to assess the role of Oxtr in diet-induced obesity and food preference. Some Oxtr phenotypes may only manifest under dietary challenge conditions .

  • Combined behavioral and molecular analysis: Correlate feeding behaviors with molecular markers of hypothalamic feeding circuits, including neuropeptide expression and neuronal activation patterns using techniques like in situ hybridization and immunohistochemistry for immediate early genes .

  • Age considerations: Design longitudinal studies that capture both early phenotypes and late-onset obesity, which typically develops around 4 months of age in Oxtr knockout mice .

How do I interpret contradictory findings between different Oxtr knockout models?

Contradictory findings between different Oxtr knockout models may arise from several factors:

  • Developmental compensation: Conventional knockouts allow for developmental adaptations that may mask phenotypes observed in acute conditional knockouts. For example, conventional Oxtr KO mice develop obesity without increased food intake, while acute conditional knockouts show both increased body weight and hyperphagia .

  • Transcript specificity: Different knockout strategies may affect distinct subsets of Oxtr transcripts. The recent identification of multiple transcript variants suggests that targeting only the canonical transcript may yield incomplete phenotypes .

  • Regional specificity: Global knockouts cannot distinguish between potentially opposing functions of Oxtr in different brain regions. Region-specific knockouts may reveal phenotypes masked in global knockouts due to balanced effects across regions .

  • Temporal dynamics: The timing of knockout induction can significantly impact observed phenotypes. Inducible systems like the Oxtr-HA-iCreERT2 line allow for investigation of age-dependent or context-dependent functions .

  • Genetic background: Differences in genetic background can modify phenotypic expression. Standardize genetic backgrounds or explicitly test for background effects in your experimental design .

When confronted with contradictory findings, systematically evaluate these factors and design experiments that directly test alternative hypotheses to resolve discrepancies.

How can emerging technologies enhance our understanding of Oxtr function?

Emerging technologies offer new opportunities for Oxtr research:

  • Single-cell RNA sequencing: This approach can reveal cell type-specific expression patterns of Oxtr transcript variants and co-expression with other relevant genes. Combined with spatial transcriptomics, it can provide unprecedented insight into the cellular context of Oxtr function.

  • CRISPR-based techniques: Beyond knockout generation, CRISPR technologies enable precise editing of specific Oxtr transcript variants or regulatory elements. CRISPR activation or interference systems can modulate expression without altering the genomic sequence .

  • Optogenetic and chemogenetic tools: When combined with Oxtr-Cre lines, these approaches allow temporally precise manipulation of Oxtr-expressing neurons. This precision is particularly valuable for dissecting Oxtr's role in acute behavioral responses .

  • In vivo calcium imaging: Using Oxtr-Cre mice to express calcium indicators in Oxtr-expressing neurons enables monitoring of their activity during naturalistic behaviors, providing insight into the functional dynamics of oxytocin-responsive circuits .

  • Epigenetic editing: Targeted modification of DNA methylation or histone modifications at Oxtr regulatory regions can help elucidate the causal role of epigenetic regulation in controlling transcript-specific expression .

What are the most promising translational applications of mouse Oxtr research?

Mouse Oxtr research has significant translational potential:

  • Obesity and metabolic disorders: Understanding how hypothalamic Oxtr signaling suppresses hyperphagia could lead to novel therapeutic approaches for obesity. The identification of specific neural circuits where oxytocin acts to regulate appetite may provide targets for intervention .

  • Social behavior disorders: Given oxytocin's role in social cognition, insights from mouse models may inform treatments for conditions like autism spectrum disorders or social anxiety. The discovery of transcript-specific functions could enable more targeted therapeutic approaches .

  • Perinatal development: Research showing that maternal oxytocin administration alters offspring Oxtr expression patterns has implications for understanding the effects of oxytocin use during labor and delivery on neurodevelopment .

  • Stress-related disorders: Oxtr's involvement in stress responses makes it relevant for conditions like PTSD and anxiety disorders. Mouse models that disambiguate different aspects of oxytocin signaling could help resolve the mixed results seen in clinical trials of oxytocin for these conditions.

  • Reproductive health: Understanding the regulation of Oxtr expression in reproductive tissues could inform treatments for labor complications and other reproductive health issues .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.