Recombinant Mouse P2Y purinoceptor 14 (P2ry14)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will fulfill your request to the best of our ability.
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time
may vary depending on the purchasing method or location. Please consult your local distributors
for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional charges will apply.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw
cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If
you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
P2ry14; Gpr105; P2Y purinoceptor 14; P2Y14; G-protein coupled receptor 105; UDP-glucose receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-338
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYL
KNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRY
YKIVKPLLTSIVQSVNYSKLLSVLVWMLMLLLAVPNIILTNQGVKEVTKIQCMELKNELG
RKWHKASNYIFVSIFWVVFLLLIVFYTAITRKIFKSHLKSRKNSTSVKRKSSRNIFSIVL
VFVVCFVPYHIARIPYTKSQTEGHYSCRTKETLLYAKEFTLLLSAANVCLDPIIYFFLCQ
PFREVLNKKLHMSLKVQNDLEVSKTKRENAIHESTDTL
Uniprot No.
Target Background
Function
This protein acts as a receptor for UDP-glucose coupled to G-proteins.
Gene References Into Functions
- Current research suggests that P2Y14 expression could serve as a phenotypic marker to further delineate placental HSPCs. PMID: 28804125
- Insulin secretion tests revealed a reduced insulin release from P2Y14-deficient islets, highlighting P2Y14 as a novel regulator of proper insulin secretion. PMID: 24993824
- This research emphasizes the physiological importance of P2Y14 receptors in the vasculature. PMID: 24911208
- P2Y14 on stem/progenitor cells of the hematopoietic system inhibits cell senescence by monitoring and responding to extracellular indications of tissue stress. PMID: 24937426
- Findings suggest that P2Y14 may function as the receptor for UDP-sugars in osteoclast precursors and potentially regulates RANKL-induced osteoclastogenesis. PMID: 24048691
- P2Y14 is a receptor that governs in utero tolerance to genotoxic stress. PMID: 23828566
- These studies indicate that GPR105 ablation mitigates high fat diet-induced insulin resistance by inhibiting macrophage recruitment and tissue inflammation. PMID: 22778393
- These results demonstrate a novel function of the P2Y14 receptor in the rodent stomach and an ability of UDP-glucose to delay gastric emptying without involving the P2Y14 receptor. PMID: 19164486
- UDP-glucose and its receptor P2RY14 are key frontline players capable of triggering innate mucosal immune responses in the FRT bypassing the recognition of pathogen-associated molecular patterns. PMID: 19454705
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
