Recombinant Mouse P2Y purinoceptor 1 (P2ry1)

Shipped with Ice Packs
In Stock

Description

Introduction to P2Y Purinoceptor 1

P2Y Purinoceptor 1 (P2ry1) belongs to the family of G-protein coupled receptors (GPCRs) that respond to extracellular nucleotides. The mouse P2ry1 gene encodes a 373-amino acid protein that functions as a receptor for adenosine diphosphate (ADP) and adenosine triphosphate (ATP) . This receptor plays crucial roles in various physiological processes, particularly in platelet aggregation and vascular function.

The P2ry1 receptor is evolutionarily conserved across mammalian species, with the mouse variant serving as an important model for understanding human P2RY1 receptor biology . Studies involving knockout mice have revealed that absence of P2Y1 receptors results in increased bleeding time and enhanced protection against collagen- and ADP-induced thromboembolism, highlighting its physiological significance .

Recombinant production of Mouse P2ry1 has enabled extensive research into its structure, function, and potential as a therapeutic target. The availability of this recombinant protein has facilitated studies ranging from basic receptor pharmacology to complex signaling pathway analyses.

Expression Systems

Recombinant mouse P2ry1 is primarily produced using bacterial expression systems, with Escherichia coli (E. coli) being the most common host . E. coli enables efficient, cost-effective production of recombinant proteins, though membrane proteins like P2ry1 can present challenges due to their hydrophobic domains.

The production process typically involves:

  1. Cloning the P2ry1 gene into a suitable expression vector

  2. Transforming the vector into E. coli

  3. Inducing protein expression under controlled conditions

  4. Cell lysis and protein extraction

  5. Purification using affinity chromatography (leveraging tags such as His-tag)

  6. Quality control testing (purity assessment, functionality tests)

Receptor Activation and Signaling

While the search results provide limited specific information about mouse P2ry1 signaling, research on P2Y1 receptors across species indicates that these receptors primarily couple to Gq/11 proteins . Upon activation by extracellular nucleotides (primarily ADP):

  1. The receptor undergoes conformational changes

  2. This activates phospholipase C

  3. Leading to generation of inositol triphosphate (IP3)

  4. Resulting in mobilization of intracellular calcium

  5. Triggering downstream cellular responses

In platelets, P2Y1 receptor activation by ADP leads to a change in platelet shape and contributes to platelet aggregation, highlighting its role in hemostasis and thrombosis .

Physiological Functions

P2Y1 receptors serve important functions in:

  • Platelet activation and aggregation

  • Vascular tone regulation

  • Neurotransmission

  • Immune response modulation

Knockout studies in mice reveal that absence of P2Y1 receptors leads to increased bleeding time and protection from thromboembolism, underscoring its importance in normal hemostasis .

Tissue Distribution

P2Y1 receptors show variable distribution across tissues. In the vascular system, studies indicate an uneven distribution along the vascular tree . While the search results don't provide comprehensive details about mouse P2ry1 distribution specifically, research on human P2Y1 receptors shows:

  • Expression in platelets

  • Presence in vascular smooth muscle cells

  • Distribution in vascular endothelium

  • Varying expression levels between different vascular segments

In placental tissue, P2Y1 receptor expression increases 6- to 8-fold from cord vessels to chorionic or cotyledon vessels, with differential distribution between smooth muscle and endothelial cells depending on the vessel type .

Subcellular Localization

The subcellular localization of P2Y1 receptors varies by cell type:

  • In cord and chorionic vessels, receptors are primarily found in smooth muscle cells

  • In cotyledon vessels, receptors are more evenly distributed between endothelium and smooth muscle cells

This differential distribution suggests specialized functions in different vascular beds and cellular compartments.

Antibodies and Detection Methods

Several tools are available for detecting and studying recombinant mouse P2ry1:

  • Polyclonal antibodies for Western blotting applications

  • Antibodies generated against specific epitopes (e.g., C-terminus)

  • Immunoblotting techniques for receptor quantification

These tools enable researchers to detect, quantify, and characterize P2ry1 expression in various experimental contexts.

Experimental Applications

Recombinant mouse P2ry1 finds application in various research methodologies:

  • Functional studies using receptor agonists and antagonists

  • Structural and binding analyses

  • Development of therapeutic agents targeting P2Y1 receptors

  • Generation of virus-like particles (VLPs) for immunization and antibody production

  • SDS-PAGE for protein characterization

Knockout mouse models lacking P2Y1 receptors have proven valuable for understanding the physiological roles of these receptors, particularly in platelet function and thromboembolic events .

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is a Tris/PBS-based buffer containing 5%-50% glycerol. Lyophilized powder is prepared using a Tris/PBS-based buffer containing 6% Trehalose before lyophilization.
Form
Liquid or Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the delivery form, please specify your needs when placing the order, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Datasheet & Coa
Please contact us to get it.
Expression Region
1-373aa
Mol. Weight
48.3 kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Neuroscience
Source
in vitro E.coli expression system
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MTEVPWSVVPNGTDAAFLAGLGSLWGNSTVASTAAVSSSFQCALTKTGFQFYYLPAVYILVFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAIYVSVLVWLIVVVAISPILFYSGTGTRKNKTVTCYDTTSNDYLRSYFIYSMCTTVAMFCIPLVLILGCYGLIVKALIYNDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPEMCDFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEEMTLNILSEFKQNGDTSL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
P2Y purinoceptor 1 (P2ry1) is a receptor for extracellular adenine nucleotides, such as ADP. In platelets, binding to ADP triggers a cascade of events, including mobilization of intracellular calcium ions via activation of phospholipase C, a change in platelet shape, and ultimately platelet aggregation.
Gene References Into Functions
  1. Upregulation of P2Y1 in cutaneous nociceptors during early life peripheral inflammation can regulate the sensitization of myelinated nociceptors to both mechanical and heat stimuli, potentially through modulation of transient receptor potential vanilloid type 1 expression. PMID: 28845731
  2. This study demonstrated that the inhibitory input to mouse cerebellar Purkinje cells is reciprocally modulated by Bergmann glial P2Y1 and AMPA receptor signaling. PMID: 27144942
  3. LPS-induced inflammation levels were comparable in P2Y1-null and wild-type mice. Specifically, splenomegaly, circulating platelet and white blood cell counts (lymphocytes and neutrophils), and lung injury assessments (tissue architecture and cell infiltration) were similar in both groups. These findings suggest that lung injury during LPS-induced inflammation in mice is independent of P2Y1 signaling. PMID: 27815804
  4. In P2Y12(-/-) mice, the growth of syngeneic ovarian cancer tumors was reduced by >85% compared with wild-type mice. Conversely, no difference in tumor growth was observed between P2Y1(-/-) and wild-type mice. PMID: 28679740
  5. Mesenteric endothelial cells are primed by schistosomiasis to a pro-inflammatory phenotype characterized by increased expression of NTPDases 2 and 3, promoting ADP accumulation and mononuclear cell adhesion. This could contribute to mesenteric inflammation and schistosomiasis morbidity via P2Y1 receptor signaling. PMID: 26924460
  6. The amounts of AChE activity, AChE catalytic subunit, structure subunit PRiMA, and acetylcholine in the brain were not significantly altered, suggesting that P2Y1R may have a different function in neurons compared to muscles. PMID: 27378627
  7. In P2Y1R (-/-) mice, the expression of P2Y2 receptor in muscle was reduced by over 50% compared to P2Y1R (+/+) mice. These findings indicate that P2Y1 receptor regulates the neuromuscular junction gene expression. PMID: 26036470
  8. The current results suggest that P2Y1 modulates heat responsiveness and chemosensation in muscle afferents, playing a key role in the development of pain-related behaviors during ischemia. PMID: 26740646
  9. Antibody EL2Ab binds to and exhibits P2Y1R-dependent function-blocking activity in the context of platelets. PMID: 25593131
  10. P2Y1 couples to and activates TRPV4. PKC inhibitors prevented P2Y1 receptor activation of TRPV4. PMID: 26475857
  11. The results of this study indicated that activation of the P2Y1R stimulates fiber growth, emphasizing the general role of this particular receptor subtype during development and regeneration. PMID: 25683778
  12. The analysis of single and double KO mice demonstrated that NTPDase2 and P2Y1 receptors are not required for murine eye formation. PMID: 25504514
  13. Data indicate that knockdown of purinergic P2Y1 receptors inhibited directed migration in neurospheres. PMID: 25096637
  14. In a mouse model of Alzheimer disease, astroglial network dysfunction is mediated by P2Y1 receptor signaling in reactive astrocytes. PMID: 25406732
  15. P2Y1R-KO mice displayed reduced cell numbers in the ganglion cell and inner nuclear layers, and ischemia induced apoptotic death of cells in all retinal layers. PMID: 25077539
  16. This study shows that Up4A is a potent native agonist for P2Y1R and SK-channel activation in human and mouse colon. PMID: 25341729
  17. RhoA signaling downstream of platelet P2Y, but not P2Y, represents a clear dichotomy in platelet activation during allergic inflammation versus hemostasis. PMID: 25445826
  18. Purines activate SK currents via mainly P2Y1 receptors in PDGFRalpha(+) cells. PMID: 24396055
  19. It is involved in LPS-induced IL-6 production in Kupffer cells, leading to liver inflammation. PMID: 24849676
  20. P2Y(1)-purinoceptors are not involved in the OFF-pathway-specific signal transmission in cholinergic amacrine cells of the mouse retina. PMID: 23907621
  21. The purinergic receptor P2Y1 mediates migration of neuroblasts within naturally occurring electric fields in the mouse brain. PMID: 23328740
  22. Activation of P2Y1 receptors in the glomerulus can stimulate network activity in the olfactory bulb. PMID: 22187118
  23. Results demonstrate a crosstalk between two metabotropic and one ionotropic purinergic receptor that regulates cAMP levels through adenylate cyclase 5 and modulates axonal elongation triggered by neurotropic factors and the PI3K-Akt-GSK3 pathway. PMID: 22250198
  24. The results of this study suggested that 9acGD3 controls granule cell progenitor migration by influencing P2Y(1)R cellular distribution and function. PMID: 22894715
  25. The current study demonstrates that P2Y1 deletion or antagonism significantly reduced venous thrombosis in mice, suggesting that P2Y1 receptors play a role in the pathogenesis of venous thrombosis. PMID: 22588534
  26. In P2Y(1)(-/-) mice, EFS responses were completely blocked by L-NNA. PMID: 22371472
  27. Purinergic responses were abolished in P2ry1(-/-) mice. PMID: 22371476
  28. Inflammation-induced enhanced expression of P2Y1 is required for normal heat sensitization of cutaneous nociceptor fibers. P2Y1 plays a role in the maintenance of phenotype in cutaneous afferent fibers. PMID: 22137295
  29. Purinergic signaling promotes the proliferation of rapidly dividing cells and transit-amplifying cells in the subventricular zone niche through the P2Y1 receptor. PMID: 22764232
  30. Activation of P2Y1 and P2Y2 receptors induces chloride secretion via calcium-activated chloride channels in kidney inner medullary collecting duct cells. PMID: 21653634
  31. The endothelial P2Yreceptor plays a key role in acute vascular inflammation and leukocyte recruitment in apoliproptein E-deficient mice. PMID: 21576651
  32. Purinergic receptor P2RY1 stimulation reduces cytotoxic edema and brain infarcts in mouse induced by photothrombosis by energizing glial mitochondria. PMID: 21203502
  33. Analysis of a novel Gi, P2Y-independent signaling pathway mediating Akt phosphorylation in response to thrombin receptors. PMID: 20586915
  34. Results demonstrate a role for the P2Y1 receptor in both arterial and venous thrombosis. Combination of P2Y1 deficiency with P2Y12 inhibition led to a significant additive effect in reducing thrombosis. PMID: 12871312
  35. In P2Y1-deficient mice, the ability of collagen to enhance the generation of thrombin was impaired. PMID: 12969982
  36. Reduced expression of P2Y1 receptors in neural progenitor cells lacking connexin43 affects calcium signaling and cell migration. PMID: 14673009
  37. Inhibition of P2Y(1) alone prolonged the lag phase preceding aggregation in response to low or high concentrations of fibrillar collagen, without affecting the maximum amplitude of aggregation or secretion. PMID: 15140133
  38. Sequential expression of the P2X5, P2Y1, and P2X2 receptors during the process of muscle regeneration. PMID: 15231720
  39. The voltage dependence to Ca2+ release via Galphaq-coupled receptors is not due to control of G-proteins or downstream signals, but rather can be explained by a voltage sensitivity at the level of the P2Y1 receptor itself. PMID: 15528188
  40. In hippocampal slices, ATP activates P2Y1 receptors in the interneurons, which is linked to activation of unidentified excitatory conductance, through mechanisms distinct from those in the astrocytes. PMID: 15574734
  41. ADP alone, used as a primary agonist, activated Rac and its effector PAK via its P2Y1 receptor, through a G(q)-dependent pathway and independently of P2Y12. PMID: 16194206
  42. Induction of the osmolyte permeability in Plasmodium-infected erythrocytes involves autocrine purinoceptor signaling. PMID: 16267125
  43. Analysis of the coupling of purinergic P2Y1R to glutamate exocytosis and its peculiar TNFalpha- and PG-dependent control. PMID: 16882655
  44. Examination of calcium mobilization in platelets from mice that were either wild-type or homozygous null for PAR-4 or P2Y1 receptors, hypothesizing that the loss of PAR-4 or P2Y1 receptors would cause redistribution of its Galphaq proteins to other receptors. PMID: 16973501
  45. Loss of P2Y1 receptor function safeguards against capillary loss, fibrosis, and death by renal failure during experimental crescentic glomerulonephritis. PMID: 17215444
  46. ATP released by nerve stimulation activates P2Y1 receptors, located prejunctionally, limiting its release by motoneurons. PMID: 17997228
  47. The P2Y(1) receptor contributes to atherosclerosis, primarily through its role in non-hematopoietic-derived cells. PMID: 18663083
  48. Findings support a potential role for P2Y1Rs in regulation of vasopressin and oxytocin release in supraoptic nucleus neurons. PMID: 19515986

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Mouse P2Y Purinoceptor 1 and how does it compare to other species?

Mouse P2Y purinoceptor 1 (P2ry1) is a G-protein coupled receptor that mediates cellular responses to extracellular ATP and related nucleotides. The mouse P2ry1 shares remarkable sequence homology with other mammalian P2Y1 receptors, particularly with rat P2ry1, demonstrating 97.1% amino acid identity . This high conservation suggests critical functional importance across mammalian species. When compared to other species, mouse P2ry1 maintains significant but variable homology, with rat and mouse sequences being most similar, while showing less identity with other vertebrates like chicken P2Y receptors . This evolutionary conservation pattern provides valuable insights for researchers designing cross-species translational studies.

What is the tissue distribution pattern of P2ry1 expression in mice?

While the search results don't specifically detail mouse P2ry1 tissue distribution, closely related rat P2ry1 mRNA is expressed at variable levels across multiple tissues including heart, brain, spleen, lung, liver, skeletal muscle, and kidney, though notably absent in testis . Given the high sequence homology between rat and mouse P2ry1 (97.1%), researchers can reasonably anticipate similar expression patterns in mice . When designing tissue-specific studies, it's advisable to perform validation experiments confirming P2ry1 expression in your tissue of interest, as expression levels may vary significantly between different physiological and pathological states.

What expression systems are most effective for recombinant mouse P2ry1 production?

Multiple expression systems have been successfully employed for mouse P2ry1 production, including E. coli, yeast, baculovirus, mammalian cells, and cell-free expression systems . Each system offers distinct advantages depending on research requirements. Mammalian expression systems typically provide proper post-translational modifications and protein folding that may be critical for functional studies. E. coli systems generally yield higher protein quantities but may require additional refolding steps. Cell-free expression systems offer rapid production with minimal contamination risks . For structural studies requiring substantial protein quantities, insect cell/baculovirus systems often represent an optimal balance between proper folding and yield. Expression system selection should align with your specific experimental endpoints and required protein characteristics.

What methodological considerations are critical when designing P2ry1 functional assays?

When designing functional assays for mouse P2ry1, several methodological considerations are essential for obtaining reliable results. First, expression system selection significantly impacts receptor functionality—Xenopus laevis oocytes have been successfully used for functional expression of P2Y purinoceptors and represent a well-established system for electrophysiological studies . For calcium signaling assays, mammalian cell lines with low endogenous P2Y receptor expression are preferable to minimize background interference. Protein purity exceeding 85% (as determined by SDS-PAGE) is generally suitable for most functional studies . When using partial recombinant constructs, ensure the expressed region includes critical functional domains—for instance, human P2RY1 expression region 326-373aa represents just one portion of the receptor and may lack complete functionality . Additionally, C-terminal tags (such as 6xHis) typically preserve receptor function better than N-terminal modifications that might interfere with ligand binding.

How should researchers address potential cross-reactivity with other purinergic receptors?

Addressing cross-reactivity concerns when studying P2ry1 requires a multi-faceted approach. P2Y purinoceptors belong to a family with five pharmacologically defined subclasses (P2X, P2Y, P2U, P2T, and P2Z), creating potential for experimental confounding . To minimize cross-reactivity issues, implement parallel control experiments with selective antagonists for non-target purinergic receptors. When using antibody-based detection methods, validate specificity through knockout/knockdown controls and pre-absorption tests. The significant sequence divergence between P2Y and other purinoceptor subtypes (for example, rat P2Y and P2U receptors share only 37.8% identity) provides opportunity for designing subtype-specific detection methods . For functional assays, carefully select agonists/antagonists with established selectivity profiles, and consider using receptor-deficient cell lines reconstituted with recombinant P2ry1 to eliminate endogenous receptor interference.

What are the key experimental considerations when comparing mouse and human P2Y1 receptor pharmacology?

When conducting comparative pharmacology between mouse P2ry1 and human P2RY1, researchers should account for several critical factors. First, despite high interspecies conservation, subtle sequence variations can significantly alter ligand binding properties and downstream signaling dynamics. Expression systems should be standardized across species comparisons—both mouse and human receptors should be expressed in identical host systems (E. coli, mammalian cells, etc.) to eliminate system-dependent variations . Protein quantification and normalization methods must be consistent to enable valid cross-species comparisons of receptor density and activity. When interpreting conflicting species-specific results, consider the potential impact of different post-translational modifications between expression systems. For partial recombinant constructs, ensure that comparable receptor regions are being compared (e.g., if using partial human P2RY1 covering amino acids 326-373, the equivalent mouse region should be used) . Additionally, pharmacological profiling should include concentration-response curves rather than single-dose experiments to accurately determine potency and efficacy differences.

What protein purification approaches yield highest quality mouse P2ry1 for structural studies?

For structural studies requiring highly purified mouse P2ry1, a multi-step purification strategy is essential. Commercial recombinant P2ry1 preparations typically achieve ≥85% purity as determined by SDS-PAGE, which may be insufficient for crystallography or cryo-EM applications . For membrane proteins like P2ry1, effective purification typically begins with affinity chromatography utilizing the His-tag commonly incorporated in recombinant constructs . This initial step should be followed by size exclusion chromatography to remove aggregates and impurities of significantly different molecular weights. For highest purity, consider incorporating an ion exchange chromatography step calibrated to P2ry1's isoelectric point. Throughout purification, maintain receptor stability by including appropriate detergents and consider adding stabilizing ligands. Monitoring receptor folding integrity throughout purification using circular dichroism or limited proteolysis is advisable. Final preparations should exceed 90% purity as confirmed by both SDS-PAGE and mass spectrometry analysis .

How can researchers effectively validate antibodies against mouse P2ry1?

Comprehensive validation of antibodies against mouse P2ry1 requires a systematic approach combining multiple methodologies. Begin with western blot analysis using recombinant mouse P2ry1 of confirmed purity (≥85%) as a positive control . Include negative controls such as lysates from P2ry1 knockout tissues or cells. Cross-reactivity assessment should include testing against related purinergic receptors, particularly P2U receptors given their structural similarities . For immunohistochemical applications, validate antibody specificity through parallel staining of wild-type and P2ry1-deficient tissues. When selecting commercial antibodies, prioritize those with documented validation in multiple applications (Western blot, immunohistochemistry, ELISA) and reactivity specifically verified against mouse P2ry1 . Consider epitope mapping to ensure antibody recognition sites do not overlap with functional domains critical to your research. For phospho-specific antibodies, verify specificity through dephosphorylation assays and phosphomimetic mutants. Finally, batch-to-batch consistency testing is essential for longitudinal studies to prevent variability in experimental outcomes.

What expression vector design principles optimize recombinant mouse P2ry1 production?

Optimizing expression vector design for mouse P2ry1 production requires careful consideration of multiple elements. For mammalian expression, strong constitutive promoters like CMV or cell-specific promoters for targeted expression should be selected based on the host system . Codon optimization for the target expression system can significantly enhance translation efficiency—particularly important when expressing mouse genes in non-mammalian hosts. For membrane proteins like P2ry1, incorporation of appropriate signal sequences facilitates proper membrane trafficking. Tag selection and positioning critically impacts both purification efficiency and receptor functionality—C-terminal tags generally preserve receptor function better than N-terminal modifications . For challenging expression cases, consider incorporating fusion partners that enhance solubility or stability. Include cleavage sites between the receptor and tags/fusion partners to enable tag removal if needed for functional studies. When designing partial constructs, ensure the expressed region encompasses complete functional domains based on receptor topology predictions. Finally, incorporate appropriate selection markers compatible with your expression system to enable effective selection of stable transfectants.

How does P2ry1 signaling differ across various mouse tissues and physiological states?

P2ry1 signaling demonstrates remarkable tissue specificity and context-dependent functionality across mouse tissues. Based on expression patterns similar to the rat ortholog, P2ry1 is widely distributed across heart, brain, spleen, lung, liver, skeletal muscle, and kidney tissues, with notable absence in testis . This differential expression correlates with tissue-specific signaling outcomes. In vascular tissues, P2ry1 primarily mediates vasodilation through calcium-dependent mechanisms, while in platelets, it contributes to aggregation responses. Neural P2ry1 signaling modulates neurotransmitter release and synaptic plasticity through distinct pathways. The receptor's absence in testis suggests evolutionary selection against purinergic signaling in this tissue, potentially to prevent inappropriate ATP-mediated responses during reproduction . When designing tissue-specific studies, researchers should account for these variations by implementing tissue-relevant functional assays rather than generic receptor activation measurements.

What are the most effective approaches for studying P2ry1 in immunological research?

For immunological research involving mouse P2ry1, several specialized approaches yield optimal results. Begin by characterizing P2ry1 expression profiles across immune cell populations using validated antibodies with confirmed specificity . Flow cytometry with fluorochrome-conjugated anti-P2ry1 antibodies (such as FITC-conjugated antibodies) enables quantitative assessment of receptor expression at the single-cell level . For functional studies, calcium flux assays using ratiometric indicators provide direct measurement of P2ry1 activation in primary immune cells. When investigating P2ry1's role in immune cell migration, transwell assays with selective agonists/antagonists can delineate receptor-specific contributions. For in vivo studies, consider generating immune cell-specific conditional P2ry1 knockout models to circumvent potential developmental compensations in global knockouts. When studying P2ry1 in inflammation models, temporal dynamics of receptor expression should be monitored, as expression levels often change dramatically during inflammatory responses. Protein-level validation using highly purified (>90%) recombinant P2ry1 standards provides necessary quantitative benchmarks for expression studies .

What experimental design considerations are critical when using recombinant P2ry1 in reconstitution studies?

Reconstitution studies with recombinant mouse P2ry1 require careful experimental design to ensure physiologically relevant outcomes. First, select an appropriate expression system—for functional membrane reconstitution, mammalian cell-derived P2ry1 typically provides superior results compared to bacterial systems due to proper post-translational modifications . Protein purity should exceed 90% as determined by SDS-PAGE to minimize artifacts from contaminants . The lipid composition of reconstitution membranes significantly impacts receptor functionality; therefore, systematic optimization with varying phospholipid ratios is advisable. For studies of P2ry1-G protein coupling, co-reconstitution with appropriate G protein subunits is essential—typically Gq/11 for canonical P2ry1 signaling. Include appropriate controls such as heat-inactivated receptor preparations and reconstitution with known non-functional receptor mutants. When measuring receptor activity in reconstituted systems, establish concentration-response relationships rather than single-concentration measurements to fully characterize receptor pharmacology. Finally, validate the orientation of reconstituted receptors using protease protection assays or antibodies targeting extracellular epitopes to confirm proper membrane topology.

How can researchers overcome common challenges in recombinant P2ry1 expression and purification?

Researchers frequently encounter several challenges when expressing and purifying recombinant mouse P2ry1, each requiring specific troubleshooting approaches. For low expression levels, optimize codon usage for your expression system and consider using stronger promoters or specialized expression strains . Insolubility issues, common with membrane proteins, can be addressed by screening multiple detergents for solubilization or employing fusion partners that enhance solubility. For aggregation problems during purification, implement size exclusion chromatography steps and consider adding stabilizing ligands throughout the purification process. Degradation during expression or purification necessitates the addition of appropriate protease inhibitors and optimization of buffer compositions. When receptor functionality is compromised, verify proper folding using spectroscopic methods and consider native purification conditions rather than denaturing/refolding approaches. For difficult-to-express constructs, cell-free expression systems offer an alternative that bypasses cellular toxicity issues . Maintaining ≥85-90% purity for functional studies typically requires multi-step purification protocols rather than single affinity steps . Finally, batch-to-batch variability can be minimized through strict standardization of expression conditions and comprehensive quality control testing of each preparation.

What analytical methods provide the most accurate assessment of recombinant P2ry1 quality and functionality?

Comprehensive quality assessment of recombinant mouse P2ry1 requires multiple analytical approaches targeting different protein characteristics. Purity assessment by SDS-PAGE should achieve ≥85-90% homogeneity as a minimum standard for most applications . Complementary purity assessment using size exclusion chromatography provides solution-state homogeneity information not captured by electrophoretic methods. Protein identity confirmation through mass spectrometry or N-terminal sequencing ensures the correct protein sequence without unexpected modifications or truncations. Functional integrity can be assessed through ligand binding assays using radiolabeled or fluorescent ligands, with binding parameters compared to literature standards. For conformational assessment, circular dichroism spectroscopy provides information about secondary structure integrity, particularly important after purification procedures. Thermal stability analysis using differential scanning fluorimetry helps identify optimal buffer conditions for maintaining receptor stability. When using tagged constructs, tag accessibility testing ensures that affinity tags remain available for downstream applications . Finally, endotoxin testing is critical for preparations intended for cell-based assays or in vivo studies, with levels typically requiring confirmation below application-specific thresholds.

What emerging technologies are advancing P2ry1 structural and functional characterization?

Cutting-edge technologies are revolutionizing mouse P2ry1 research across multiple fronts. Cryo-electron microscopy now enables structural determination of P2ry1 in near-native conformations without crystallization requirements, providing unprecedented insights into activation mechanisms. Single-molecule fluorescence approaches reveal real-time conformational dynamics of P2ry1 during ligand binding and G-protein coupling. CRISPR-Cas9 gene editing facilitates precise genomic modifications to study endogenous P2ry1 function, overcoming limitations of overexpression systems . Nanobody development against specific P2ry1 conformational states offers highly selective tools for stabilizing discrete receptor conformations. Advanced reconstitution systems, including nanodiscs and polymer-based systems, provide more native-like membrane environments than traditional detergent systems. Improved recombinant protein production strategies using specialized expression hosts achieve higher yields of properly folded receptor, enhancing structural and biochemical studies . For pharmacological profiling, bioluminescence resonance energy transfer (BRET) biosensors enable real-time monitoring of P2ry1 activation in living cells. These technological advances collectively propel P2ry1 research toward more physiologically relevant insights and potential therapeutic applications.

How can computational approaches enhance P2ry1 research and drug discovery efforts?

Computational methods are increasingly integral to P2ry1 research, offering powerful complements to experimental approaches. Homology modeling leveraging the high sequence identity between mouse P2ry1 and structurally characterized homologs (97.1% identity with rat P2Y) enables detailed structural predictions for mouse-specific studies . Molecular dynamics simulations reveal conformational landscapes and allosteric communication networks within the receptor. Structure-based virtual screening against P2ry1 binding sites identifies novel ligand scaffolds with unique pharmacological profiles. Machine learning approaches integrating experimental binding data can predict structure-activity relationships for rational ligand optimization. Network analysis of P2ry1 protein interaction partners helps identify previously unrecognized signaling pathways and functional relationships. Molecular docking studies facilitate prediction of species-specific pharmacological differences between mouse and human receptors, guiding translational research . Systems biology modeling incorporating P2ry1 signaling provides context for receptor function within broader cellular networks. For researchers with limited computational expertise, user-friendly platforms now exist that integrate multiple computational approaches specifically tailored for GPCR research, making these sophisticated methods more accessible.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.