Recombinant Mouse P2Y purinoceptor 4 (P2ry4)

Shipped with Ice Packs
In Stock

Description

Expression Systems and Purity

Recombinant mouse P2ry4 can be produced using several expression systems, each offering distinct advantages depending on research requirements. Available host systems include prokaryotic (E. coli), eukaryotic (yeast, mammalian cells), baculovirus-infected insect cells, and cell-free expression systems . Each expression platform influences protein folding, post-translational modifications, and ultimately the functional properties of the recombinant receptor.

The purity of commercially available recombinant mouse P2ry4 typically exceeds 85% as determined by SDS-PAGE analysis . This high level of purity is essential for experimental reliability, particularly in pharmacological studies, binding assays, and structural investigations where contaminants could compromise results.

Full-Length and Partial Recombinant Variants

Two primary variants of recombinant mouse P2ry4 are available for research applications: full-length and partial. The full-length variant contains the complete amino acid sequence of the native receptor, while partial variants may contain specific functional domains of interest. The partial mouse P2ry4 variant has been annotated with gene names including P2ry4, P2Y4, and P2Y4R . These partial constructs may be particularly valuable for structural studies focusing on specific receptor regions or for investigating domain-specific functions.

Functional Properties of Recombinant Mouse P2ry4

P2Y receptors, including P2ry4, function as metabotropic receptors that couple to intracellular G-proteins upon activation by extracellular nucleotides. While the P2X receptor family forms ligand-gated ion channels, P2Y receptors like P2ry4 operate through second messenger systems, typically activating phospholipase C, modulating intracellular calcium levels, or affecting adenylyl cyclase activity.

It's important to note that mouse P2ry4 exhibits distinct pharmacological properties compared to other P2Y receptor subtypes and P2X receptors. Unlike P2X4 receptors, which respond primarily to ATP with EC50 values in the low micromolar range (2.3 μM for mouse P2X4), P2Y4 receptors typically show higher sensitivity to pyrimidine nucleotides such as UTP .

Species Variations in P2Y4 Receptors

Comparison studies between species orthologues reveal important differences in receptor pharmacology. While detailed comparative data specifically for mouse P2ry4 is limited in the available search results, research on related purinergic receptors demonstrates that mouse receptors often show distinct pharmacological profiles compared to their human and rat counterparts . These differences highlight the importance of species-specific investigations when modeling human disease states or developing therapeutic compounds targeting these receptors.

Expression Systems for Recombinant Mouse P2ry4 Production

The choice of expression system significantly impacts the properties of recombinant mouse P2ry4. Each system offers distinct advantages and limitations that researchers must consider based on their specific experimental requirements.

Host System Comparison

The following table summarizes the major expression systems used for recombinant mouse P2ry4 production:

Expression SystemAdvantagesLimitationsApplications
E. coliHigh yield, cost-effective, rapid productionLimited post-translational modifications, potential improper foldingStructural studies, antibody production
YeastModerate yield, some post-translational modificationsNot all mammalian modifications presentFunctional studies requiring basic glycosylation
Baculovirus/InsectHigher-order protein folding, complex modificationsModerate cost, longer production timeReceptor binding studies, signaling assays
Mammalian CellNative-like folding and modificationsHigher cost, lower yield, longer production timeDrug screening, detailed functional characterization
Cell-Free ExpressionRapid, avoids cellular toxicity issuesLimited post-translational modificationsPreliminary screening, structural studies

All recombinant mouse P2ry4 products achieve a purity of at least 85% as determined by SDS-PAGE analysis, making them suitable for most research applications .

Research Applications of Recombinant Mouse P2ry4

Recombinant mouse P2ry4 serves as a valuable tool in numerous research contexts, enabling investigations into purinergic signaling that would be challenging with native receptor systems.

Fundamental Research Applications

In basic science research, recombinant mouse P2ry4 facilitates studies of receptor structure-function relationships, ligand binding properties, and signaling pathway elucidation. The availability of purified recombinant protein allows for controlled experimental conditions that minimize variables present in complex cell or tissue preparations.

The receptor can be used in reconstitution experiments, where the purified protein is incorporated into artificial membrane systems to study its biophysical properties in isolation. Additionally, recombinant P2ry4 serves as an antigen for generating specific antibodies, enabling improved detection and localization studies in native tissues.

Drug Discovery and Therapeutic Development

Recombinant mouse P2ry4 provides a platform for screening potential therapeutic compounds targeting purinergic signaling pathways. High-throughput screening approaches can identify novel agonists, antagonists, or allosteric modulators with potential therapeutic applications.

The comparison between mouse and human P2Y4 receptors offers insights into species-specific pharmacology, which is critical for translational research. Compounds showing efficacy at mouse P2ry4 can be further evaluated against the human orthologue to assess their potential for human therapeutic applications.

Comparison with Related Purinergic Receptors

Understanding the relationship between P2ry4 and other purinergic receptors provides important context for its specific functions and applications.

P2Y4 vs. P2X4 Receptors

While both belong to the purinergic receptor superfamily, P2Y4 and P2X4 receptors differ fundamentally in structure and signaling mechanisms. P2X4 receptors function as ligand-gated ion channels that open in response to ATP binding, allowing cation influx directly through the receptor channel . In contrast, P2Y4 receptors operate through G-protein coupled signaling cascades, initiating second messenger pathways rather than direct ion conductance.

Pharmacologically, these receptor families show distinct profiles. Mouse P2X4 responds to ATP with an EC50 of approximately 2.3 μM and shows partial responses to α,β-methylene ATP and adenosine-5′-tetraphosphate (AP4) . P2Y4 receptors typically display greater sensitivity to pyrimidine nucleotides like UTP than to ATP.

Species Differences in Purinergic Receptor Pharmacology

Research has demonstrated significant pharmacological differences between species orthologues of purinergic receptors. For instance, mouse P2X4 receptors show greater pharmacological similarity to human P2X4 than to rat P2X4, particularly in their sensitivity to antagonists like PPADS . Similarly, P2Y4 receptors likely exhibit species-specific pharmacological profiles that researchers must consider when translating findings between model systems and human applications.

Technical Considerations for Working with Recombinant Mouse P2ry4

Successful utilization of recombinant mouse P2ry4 in research settings requires attention to several technical factors that can influence experimental outcomes.

Experimental Design Considerations

When designing experiments with recombinant mouse P2ry4, researchers must consider several factors:

  1. The expression system used for protein production may influence receptor properties

  2. The presence of fusion tags or additional sequences may affect function or require removal

  3. Reconstitution into appropriate membrane environments is crucial for maintaining native-like activity

  4. The purity level (typically ≥85%) may impact experimental outcomes, particularly in sensitive assays

These technical considerations highlight the importance of thorough methodology and appropriate controls when working with recombinant receptor proteins.

Future Directions in P2ry4 Research

While current research has established foundational knowledge about mouse P2ry4, several areas warrant further investigation to enhance our understanding of this receptor's biology and potential applications.

Physiological Role Elucidation

Further research is needed to fully characterize the physiological and pathophysiological roles of P2ry4 in mouse models. Genetic approaches, including conditional knockout strategies, combined with recombinant protein tools, will help establish the context-specific functions of this receptor in various tissues and disease states.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will then prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for the specific delivery time.
Note: All our proteins are shipped with normal blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
P2ry4; P2y4r; P2Y purinoceptor 4; P2Y4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-361
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MTSADSLLFTSLGPSPSSGDGDCKFNEEFKFILLPLSYAVVFVLGLALNAPTLWLFLFRL RPWDATATYMFHLALSDTLYVLSLPTLVYYYAARNHWPFGTGFCKFVRFLFYWNLYCSVL FLTCISVHRYMGICHPLRAIRWGRPRFAGLLCLGVWLVVAGCLVPNLFFVTTNANGTTIL CHDTTLPEEFDHYVYFSSTIMVLLFGFPFLITLVCYGLMARRLYRPLPGAGQSSSRLRSL RTIAVVLTVFAVCFVPFHITRTIYYLARLLNAECRVLNIVNVVYKVTRPLASANSCLDPV LYLFTGDKYRNQLQQLCRGSTPKRRTTASSLALVTLHEESISRWADIHQDSIFPAYEGDR L
Uniprot No.

Target Background

Function
This receptor is a G-protein coupled receptor for ATP and UTP, activating a phosphatidylinositol-calcium second messenger system.
Gene References Into Functions
  1. Research suggests that the P2Y4 receptor acts as an inhibitor of cardiac fat formation. PMID: 27855539
  2. In brain samples, P2Y4 and P2X7 expression levels were significantly reduced, while P2Y1 expression was significantly elevated in an age-dependent manner. PMID: 28322086
  3. Studies have shown that activation of the P2Y4 nucleotide receptor in differentiating embryonic stem cells (ESCs) leads to an increased proportion of neurons expressing vesicular glutamate transporter (vGluT). PMID: 26972684
  4. This research identifies the P2Y4 nucleotide receptor, expressed on cardiac microvascular endothelial cells and involved in postnatal heart development, as a key regulator of the inflammatory response to cardiac ischemia. PMID: 25595790
  5. Amyloid beta peptide 1-42 induced self-uptake in microglia through pinocytosis, a process involving activation of P2Y4 receptors by autocrine ATP signaling. PMID: 24001770
  6. The P2Y(4) receptor could play a significant role in regulating both acute and chronic responses to exercise. PMID: 22865387
  7. This study highlights the mouse P2Y(4) receptor as a crucial regulator of cardiac endothelial cell function, demonstrating the involvement of endothelial-cardiomyocyte interactions in post-natal heart development. PMID: 22437266
  8. Purinergic receptors may represent important new molecular targets for theca hyperplasia and polycystic ovarian syndrome. PMID: 20630102
  9. Knock-out mice studies reveal tissue-specific roles of P2Y receptor subtypes in different epithelia. PMID: 12644577
  10. Purinergic receptors on microglial cells demonstrate functional expression in acute brain slices and modulation of microglial activation in vitro. PMID: 12814360
  11. Both P2Y2 and P2Y4 receptors are present in the luminal membrane of mouse distal colonic mucosa, and stimulation of these receptors leads to potassium ion secretion. PMID: 15718265
  12. The role of P2Y2 and P2Y4 receptors in peritoneal macrophage calcium signaling is reported. PMID: 16980298
  13. Functional purinergic (P2Y4) neuron-glia communication in the enteric nervous system has been demonstrated, suggesting that ATP released with neurotransmitters during enteric synaptic transmission functions to signal to enteric glia. PMID: 19250649
  14. AQP2-mediated water transport is downregulated not only by basolateral nucleotides, mediated by P2Y(2) receptors, but also by luminal nucleotides, mediated by P2X(2) and/or P2Y(4) receptors. PMID: 19423692

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the liver, intestine, stomach, bladder and lung.

Q&A

What is the structure and functional profile of mouse P2Y4 receptors compared to human and rat orthologs?

Mouse P2Y4 receptor is a G protein-coupled receptor with seven transmembrane spanning regions, consisting of 361 amino acids. It shares 95% amino acid identity with rat P2Y4 and 82% with human P2Y4 . P2Y4 receptors couple primarily to Gq proteins, activating phospholipase C (PLC), leading to inositol 1,4,5-trisphosphate (IP3) production and subsequent Ca2+ release from intracellular stores .

Species differences are significant:

  • Mouse P2Y4 is equally activated by ATP and UTP

  • Human P2Y4 is primarily a UTP-selective receptor

  • Rat P2Y4 shows similar pharmacology to mouse P2Y4

Antagonist sensitivity also varies between species, with mouse and human P2Y4 being sensitive to PPADS (IC50 ≈ 10.5 μM and 9.6 μM respectively), while rat P2Y4 shows low sensitivity to this antagonist (IC50 >100 μM) .

Which tissues express P2Y4 receptors in mice and how can this expression be detected?

P2Y4 mRNA in mice has been detected in multiple tissues using reverse transcription and polymerase chain reaction (RT-PCR):

TissueRelative Expression
LiverHigh
IntestineHigh
StomachHigh
BladderHigh
LungHigh
BrainModerate, region-specific

In the brain, P2Y4 shows enriched expression in specific regions :

  • Neural crest cells during development

  • Neuronal precursors during differentiation

  • Type 2b neural stem cells in adult hippocampus

Detection methods for P2Y4 expression include:

  • RT-PCR for mRNA detection across tissues

  • In situ hybridization for spatial expression patterns

  • Immunohistochemistry with validated antibodies

  • Generation of reporter mouse lines (similar to P2rx4-tdTomato mice)

What expression systems are recommended for functional studies of recombinant mouse P2Y4?

Multiple expression systems have been validated for recombinant mouse P2Y4 studies:

Expression SystemApplicationsNotes
1321N1 cellsPharmacological characterizationHuman astrocytoma cells with minimal endogenous P2 receptor expression
HEK-293 cellsElectrophysiology, signaling studiesStable expression allows consistent responses
Xenopus oocytesElectrophysiological characterizationGood for initial functional characterization

Methodological recommendations:

  • For calcium imaging: Use stable cell lines with consistent receptor expression levels

  • For electrophysiology: Use Cs-aspartate containing electrodes (3-8 MΩ) in HEPES-buffered extracellular medium

  • For binding studies: COS-7 cells have shown high expression levels for related receptors

How can functional activity of recombinant mouse P2Y4 receptors be quantitatively measured?

Multiple complementary approaches can be used:

Calcium Mobilization Assays:

  • Load cells with ratiometric (Fura-2) or single-wavelength (Fluo-4) calcium indicators

  • Measure fluorescence changes following receptor stimulation

  • Quantify peak amplitude, duration, and oscillation frequency

  • Can detect different patterns of calcium signaling (sustained vs. oscillatory)

Electrophysiological Measurements:

  • Whole-cell patch clamp recordings in expression systems

  • Typical parameters: EC50 values for ATP at mouse P2Y4 ≈ 2.3 μM

  • Compare responses to different agonists as percentage of maximum ATP response

  • Measure current-voltage relationships to confirm channel properties

Inositol Phosphate Accumulation:

  • Pre-label cells with [3H]inositol

  • Measure accumulation of IP3 following receptor activation

  • Use LiCl to inhibit inositol phosphate degradation for cumulative measurements

G-protein Coupling Analysis:

  • Use pertussis toxin to differentiate between Gq and Gi coupling

  • Measure cAMP levels to detect potential coupling to Gs/Gi proteins

  • PKC modulation affects calcium signaling patterns (frequency and spike width)

What is the detailed pharmacological profile of mouse P2Y4 and how does it compare to other P2Y subtypes?

Agonist Profile for Mouse P2Y4:

AgonistEfficacy (% of ATP)EC50 (μM)Notes
ATP100%2.3Full agonist
UTP100%Similar to ATPFull agonist
α,β-meATP29%7.0Partial agonist
AP469%2.6Partial agonist

Antagonist Profile:

AntagonistIC50 (μM)Notes
PPADS10.5Effective antagonist
Reactive Blue 2EffectiveSpecific IC50 not reported
SuraminIneffectiveDistinguishes from P2Y1

Species Differences:

  • For rat P2Y4: α,β-meATP is an antagonist (IC50 = 4.6 μM)

  • For human P2Y4: PPADS IC50 = 9.6 μM

P2Y Subtype Comparison:

  • P2Y1: Prefers ADP > ATP; inhibited by suramin

  • P2Y2: Responds equally to ATP and UTP

  • P2Y6: Prefers UDP

  • P2Y12-14: Couple primarily to Gi proteins (vs. Gq for P2Y4)

What genetic approaches can be used to investigate P2Y4 function in mouse models?

Knockout Strategies:

  • Conventional P2Y4 knockout mice show phenotypes related to:

    • Improved glucose tolerance and insulin sensitivity

    • Protection against myocardial infarction

    • Increased adiponectin secretion

    • Decreased cardiac inflammation

TALEN-Mediated Gene Disruption:

  • Transcription activator-like effector nuclease (TALEN) has been used for targeted disruption of P2Y4

  • Left and right TALEN pairs (50 pg each) can be injected to disrupt gene function

  • DNA sequencing confirms target gene disruption

  • Phenotypic analysis at relevant developmental stages

siRNA Knockdown:

  • Effective for in vitro studies

  • Transfection of P2Y4-specific siRNAs reduces receptor expression

  • Verify knockdown by western blot or qPCR

  • Functional consequences can be measured by calcium imaging or other assays

Reporter Strategies:

  • Generation of P2Y4 reporter mice (similar to P2rx4-tdTomato mice)

  • Crossing with cell-specific reporter lines to identify cellular expression

  • Combined with functional studies to correlate expression with physiological roles

What is known about the role of P2Y4 receptors in neuronal development and differentiation?

P2Y4 plays a critical role in neuronal development through multiple mechanisms:

Expression in Neuronal Precursors:

  • Expression peaks during neuronal differentiation from embryonic stem cells

  • Transiently increases during differentiation after loss of pluripotency (Oct4) but before terminal differentiation

Glutamatergic Neuron Specification:

  • P2Y4-Gq signaling axis induces glutamatergic markers

  • UTP stimulation increases vesicular glutamate transporter expression

  • siRNA knockdown of P2Y4 inhibits UTP-dependent induction of glutamatergic neurons

  • Detected predominantly in type 2b neural stem cells in adult hippocampus

Head Development:

  • P2Y4 is required for head organizer formation during neural induction in Xenopus

  • Disruption results in small head phenotype and reduced expression of head organizer genes (dkk1, cerberus)

  • Reduction in neural crest marker expression (snail1, hairy2b) at neurula stage

  • TALEN-mediated knockout disrupts anterior neural development

Mechanism of Action:

  • P2Y4 receptor activation induces calcium signaling in neural progenitors

  • Required for proper neural crest cell formation and migration

  • May regulate cell proliferation to maintain progenitor cells in an undifferentiated state

How does P2Y4 function in cardiovascular health and glucose metabolism?

P2Y4 has emerged as an important regulator of both cardiovascular function and glucose homeostasis:

Cardiovascular Protection:

  • P2Y4 knockout mice show protection against myocardial infarction

  • Smaller infarcts in the left anterior descending coronary artery ligation model

  • Significant decrease in cardiac inflammation and permeability

  • Higher levels of cardioprotective adiponectin correlate with increased cardiac adipose tissue

N178T Polymorphism Effects:

  • Loss-of-function variant in human P2Y4 receptor

  • Located in the second extracellular loop

  • Less frequent in coronary artery disease patients than in controls

  • Associated with:

    • Reduced cardiac severity scores (jeopardy and Gensini)

    • Lower resting heart rates

    • Reduced plasma NT-proBNP levels

    • Lower fasting glucose concentration

Glucose Metabolism:

  • P2Y4 knockout mice show:

    • Significantly improved glucose tolerance

    • Enhanced insulin sensitivity

    • These effects are dependent on adiponectin (not observed in adiponectin/P2Y4 double-KO mice)

  • P2Y4 receptors can regulate Cl- and K+ channels and intracellular Ca2+ signaling in pancreatic ducts

Therapeutic Implications:

  • P2Y4 antagonists may have applications in treating:

    • Myocardial infarction

    • Type 2 diabetes

    • Insulin resistance

What methods are available to study the structural aspects of P2Y4 receptors?

Computational Approaches:

  • Homology modeling based on related P2Y receptor crystal structures

  • Molecular dynamics simulations to study receptor flexibility and ligand interactions

  • AlphaFold/ColabFold predicted structural models, especially valuable when experimental structures are unavailable

Mutagenesis Studies:

  • Site-directed mutagenesis to identify key residues for ligand binding or receptor function

  • Mutation types include:

    • Reduction of side chain size (e.g., to Ala) to reduce ligand interactions

    • Introduction of bulkier side chains (e.g., to Trp) to create steric hindrance

    • Charge alterations to disrupt electrostatic interactions

Structural Comparison:

  • Comparison with experimental structures of related receptors (e.g., P2X4)

  • Focus on conserved residues and binding pockets

  • Analysis of species differences in key binding regions

Functional Validation:

  • Patch-clamp recordings of mutant receptors

  • Calcium imaging to assess functionality of mutants

  • Binding studies with labeled agonists/antagonists

  • Assessment of agonist/antagonist potency alterations in mutants

While no crystal structure of P2Y4 has been reported, insights can be gained from structures of related receptors combined with careful functional studies of mutant receptors.

How can differential Ca2+ signaling patterns mediated by P2Y4 be analyzed and interpreted?

P2Y4 activation generates complex calcium signaling patterns that can be analyzed through multiple approaches:

Calcium Oscillation Analysis:

  • P2Y4 activation typically produces oscillatory Ca2+ responses

  • Key parameters to measure:

    • Oscillation frequency

    • Spike amplitude

    • Spike width (duration)

    • Time to first peak

    • Pattern sustainability

Regulatory Mechanisms:

  • PKC modulation affects P2Y receptor calcium signaling:

    • PKC activation decreases oscillation frequency for P2Y1

    • Both PKC activation and inhibition decrease spike width for P2Y2/4, suggesting multiple opposing feedback mechanisms

    • Plasma membrane Ca2+ entry required for negative PKC feedback on P2Y1 but not for P2Y2/4

Analytical Approaches:

  • Real-time imaging with high temporal resolution (>1 Hz)

  • Single-cell analysis to capture heterogeneity

  • Automated analysis software to quantify oscillation parameters

  • Pharmacological dissection using channel blockers and pathway inhibitors

Physiological Relevance:

  • Different patterns of calcium signaling can encode specific cellular responses

  • Oscillation frequency may determine which downstream pathways are activated

  • Understanding these patterns helps interpret P2Y4-specific functions in different cell types

What are the current challenges in developing selective pharmacological tools for P2Y4 research?

Subtype Selectivity:

  • High sequence similarity between P2Y receptor subtypes complicates selective tool development

  • Limited structural information specific to P2Y4

  • Need to distinguish from closely related P2Y2 which shares similar agonist profile

Species Differences:

  • Significant pharmacological differences between human, mouse, and rat P2Y4 orthologues

  • Mouse/rat P2Y4 activated equally by ATP and UTP, while human P2Y4 is UTP-selective

  • Species-dependent antagonist sensitivity (e.g., PPADS effective at mouse/human but not rat P2Y4)

Binding Site Characterization:

  • Limited information on precise binding sites for P2Y4 agonists and antagonists

  • Need for systematic mutagenesis studies similar to those for P2X receptors

  • Requirement for robust expression systems that maintain proper receptor folding and function

Design Strategy Recommendations:

  • Focus on extracellular loop regions where sequence divergence is greatest

  • Target allosteric sites rather than orthosteric sites for greater selectivity

  • Develop antibody-based approaches for selectivity when small molecules fail

  • Use complementary genetic approaches (siRNA, CRISPR) to validate pharmacological findings

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.