Recombinant Mouse p53 apoptosis effector related to PMP-22 (Perp)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for the estimated delivery time.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Perp; Krtcap1; p53 apoptosis effector related to PMP-22; Keratinocyte-associated protein 1; KCP-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-193
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MLRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSNHIQTSSLWWRCFDEGGGSGS YDDGCQSLMEYAWGRAAAATLFCGFIILCICFILSFFALCGPQMLVFLRVIGGLLALAAI FQIISLVIYPVKYTQTFRLHDNPAVNYIYNWAYGFGWAATIILIGCSFFFCCLPNYEDDL LGAAKPRYFYPPA
Uniprot No.

Target Background

Function
Perp is a component of intercellular desmosome junctions. It plays a crucial role in maintaining the integrity of stratified epithelium and cell-cell adhesion by promoting desmosome assembly. Additionally, Perp acts as an effector in the TP53-dependent apoptotic pathway.
Gene References Into Functions
  1. Perp might play important roles in the formation and integration of stellate reticulum, dental lamina structure, and enamel formation PMID: 24865245
  2. Perp plays a significant role in normal mammary tissue function and mammary cancer suppression PMID: 22515648
  3. Research indicates that PERP is essential for the integrity of the ameloblast-SI interface, and a lack of Perp causes downregulation of genes required for proper enamel formation. PMID: 21285247
  4. Studies suggest that Perp deficiency promotes cancer by enhancing cell survival, desmosome loss, and inflammation, highlighting a fundamental role for Perp and desmosomes in tumor suppression. PMID: 20975948
  5. In contrast to p53 shRNAs, PUMA shRNAs were unable to cooperate with oncogenic ras in transformation PMID: 15192153
  6. Perp is a key effector in the p63 developmental program. PMID: 15797384
  7. Perp is required for efficient skin carcinogenesis, suggesting a role for intact cell-cell adhesion in supporting tumor development in these settings. PMID: 16061634
  8. Perp's requirement for both viability and epithelial integrity reflects a role in the stratified epithelial compartment. PMID: 16417219
  9. Perp is required throughout adult life for proper epithelial homeostasis and function. PMID: 16485031
  10. Pemphigus vulgaris autoantibodies disrupt Perp expression at the membrane and trigger its internalization along with DSG3 into the endosomal pathway, where it is ultimately targeted to the lysosome for degradation. PMID: 19158843
  11. A paper describes the identification of Perp (p53 Apoptosis Effector Related to PMP22). Perp was found as a novel target gene of the p53 tumor suppressor, which is selectively induced during apoptosis compared to cell cycle arrest. PMID: 10733530

Show More

Hide All

Database Links
Protein Families
TMEM47 family
Subcellular Location
Cell junction, desmosome. Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the stratified squamous skin epithelium of the skin and the tongue, but not in simple epithelia (at protein level). Expressed in apoptotic cells.

Q&A

What is PERP and how was it initially identified?

PERP was identified through a subtractive cloning strategy designed to isolate genes specifically upregulated by p53 during apoptosis. Researchers compared gene expression profiles between DNA damage-induced G1-arrested mouse embryonic fibroblasts (MEFs) and apoptotic MEFs expressing adenovirus E1A oncoprotein. This approach revealed PERP as a novel p53 target gene that is expressed at significantly higher levels in apoptotic cells compared to G1-arrested cells . PERP shows sequence similarity to the PMP-22/gas3 tetraspan membrane protein family, which is implicated in hereditary human neuropathies such as Charcot–Marie–Tooth disease . This physiological approach, utilizing the response of endogenous cellular p53 to DNA damage in primary cells, provided a more accurate representation of PERP's role than previous studies comparing cell lines lacking p53 with those overexpressing p53 .

What is the molecular structure of PERP and how does it relate to its function?

PERP is a plasma membrane protein that belongs to the PMP-22/gas3 tetraspan membrane protein family . Its structural characteristics include four transmembrane domains that anchor it within the cell membrane. This structural arrangement is crucial for PERP's pro-apoptotic function. When expressed in fibroblasts, PERP localizes to the plasma membrane and induces cell death . The protein's structural integrity is essential for its ability to participate in the p53-mediated apoptotic response. While the precise mechanism by which PERP's structure facilitates apoptosis remains under investigation, its membrane localization suggests it may function by altering membrane permeability or by participating in signaling cascades that culminate in apoptotic cell death.

How is PERP expression regulated at the transcriptional level?

PERP is primarily regulated as a direct transcriptional target of p53, but its expression can also be modulated by other transcription factors . The PERP promoter contains at least three p53 response elements located in the promoter region and first intron . These sites are occupied in vivo in E1A-expressing mouse embryo fibroblasts undergoing apoptosis but not in those undergoing cell cycle arrest . This selective binding pattern differs from other p53 target genes like p21, whose response elements are occupied during both apoptosis and cell cycle arrest . Time course analysis has shown that PERP expression increases following p53 activation during apoptosis, with kinetics consistent with direct transcriptional regulation . Additionally, mutations in p53 that affect its DNA-binding capabilities, such as the p53V143A point mutant, demonstrate selective deficits in binding to PERP response elements while maintaining binding to p21 elements, further supporting the distinct regulation of PERP during apoptosis .

How does PERP expression influence p53 stability and activity?

Intriguingly, while PERP is a transcriptional target of p53, recent research has uncovered a reciprocal relationship where PERP expression positively influences active levels of p53. Studies using fluorescent fusion proteins of PERP, p53, and MDM2 have demonstrated that PERP expression significantly enhances p53 activity and its nuclear localization in living uveal melanoma cells . This enhancement occurs through several mechanisms. First, PERP expression increases p53-dependent transcription, including that of MDM2, while allowing oscillatory nucleo-cytoplasmic shuttling of p53/MDM2 complexes . Second, PERP expression leads to phosphorylation of p53 serine residues that interfere with the interaction between p53 and its negative regulator MDM2, thereby stabilizing p53 . Third, PERP-induced phosphorylation enhances p53's ability to activate pro-apoptotic gene transcription. These findings reveal a positive feedback loop where PERP amplifies functional p53 levels that, in turn, promote p53-dependent apoptosis .

What is the significance of p53 binding differences between PERP and other target genes?

The p53 protein demonstrates differential binding patterns to the response elements of its various target genes, which contributes to the selective expression of certain genes during specific cellular responses. Research has shown that p53 binds differently to PERP response elements compared to the response elements of other target genes such as p21 . This differential binding is particularly evident during apoptosis versus cell cycle arrest. The PERP elements are occupied in vivo in E1A-expressing mouse embryo fibroblasts undergoing apoptosis but not cell cycle arrest . In contrast, the p21 5' response element is occupied during both processes. Furthermore, the apoptosis-deficient p53 point mutant, p53V143A, exhibits a selective deficit in binding to PERP elements while maintaining its ability to bind to p21 elements . This selective binding provides mechanistic insight into how p53 can distinguish between target genes at the DNA binding level, allowing for the preferential activation of specific pathways depending on the cellular context and signals received.

How do specific p53 mutations affect PERP induction and function?

Specific p53 mutations can significantly alter PERP induction and its subsequent function in apoptosis. The p53V143A point mutant, for example, demonstrates a selective deficit in binding to PERP response elements while maintaining binding to other target gene elements such as p21 . This mutation renders p53 deficient in inducing apoptosis while preserving its ability to induce cell cycle arrest. Studies employing homologous recombination and LoxP/Cre-mediated deletion have produced mutant murine embryonic stem cells expressing p53 with Gln and Ser in place of Leu25 and Trp26 . These substitutions disrupt the interaction between p53 and Mdm2, leading to p53 stability, but they also render p53 transcriptionally inactive . Consequently, these mutant cells fail to express p53-dependent genes like p21 and PERP following DNA damage, despite having high basal levels of p53 protein . This demonstrates how specific mutations in p53 can differently affect its ability to induce various target genes, including PERP, with profound consequences for the cell's ability to undergo apoptosis in response to stress signals.

What are the recommended techniques for detecting and quantifying PERP expression?

For effective detection and quantification of PERP expression, researchers should employ a combination of techniques targeting both mRNA and protein levels. At the mRNA level, quantitative real-time PCR (qRT-PCR) provides a sensitive method for measuring PERP transcript abundance. Primers should be designed to span exon-exon junctions to avoid genomic DNA amplification. Northern blot analysis can also be used to verify transcript size and integrity . For protein detection, Western blot analysis using specific anti-PERP antibodies is the standard approach. As demonstrated in studies with recombinant proteins, approximately 50 ng of protein is sufficient for chemiluminescence detection methods . Immunofluorescence microscopy is valuable for visualizing PERP's subcellular localization, particularly its expected plasma membrane distribution. For more precise quantification in living cells, fluorescent fusion proteins of PERP can be employed, allowing real-time observation of expression and localization changes . Flow cytometry using fluorescently-labeled antibodies provides another quantitative approach, especially useful when analyzing heterogeneous cell populations.

How can researchers effectively establish PERP knockout or knockdown models?

Establishing effective PERP knockout or knockdown models requires careful consideration of the experimental approach. For transient knockdown, RNA interference (RNAi) using small interfering RNAs (siRNAs) or short hairpin RNAs (shRNAs) targeting PERP mRNA can reduce expression levels by 70-90%. When designing siRNAs, researchers should target regions with minimal sequence homology to other genes, particularly other PMP-22/gas3 family members, to avoid off-target effects. For stable knockdown, lentiviral or retroviral vectors expressing shRNAs provide long-term suppression of PERP expression. For complete gene knockout, CRISPR-Cas9 technology offers precise genome editing capabilities. Guide RNAs should be designed to target early exons of the PERP gene to ensure complete loss of function. Following the establishment of knockout/knockdown models, validation is essential through multiple methods including qRT-PCR, Western blotting, and functional assays. Researchers should also characterize potential compensatory mechanisms, as other p53 target genes or PMP-22/gas3 family members might be upregulated in response to PERP depletion.

What are the optimal conditions for producing recombinant mouse PERP protein for in vitro studies?

Production of recombinant mouse PERP protein requires specialized approaches due to its nature as a tetraspan membrane protein. Based on protocols established for similar proteins, the Baculovirus Expression Vector System (BEVS) in Sf9 insect cells is recommended as it facilitates proper folding of membrane proteins . The PERP coding sequence should be cloned into a baculovirus transfer vector containing an appropriate tag (e.g., His-tag, FLAG-tag) for purification. After viral amplification, Sf9 cells should be infected at a multiplicity of infection (MOI) of 2-5 and harvested 48-72 hours post-infection. For extraction, mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin are preferable to preserve protein structure. Purification can be achieved using affinity chromatography corresponding to the chosen tag, followed by size exclusion chromatography to ensure homogeneity. The purified protein should be maintained in a detergent-containing buffer to prevent aggregation. Quality control measures include SDS-PAGE and Western blot analysis to verify purity and integrity . For functional studies, the recombinant protein can be reconstituted into liposomes or nanodiscs to mimic its native membrane environment.

How does PERP facilitate p53-dependent apoptosis at the molecular level?

PERP facilitates p53-dependent apoptosis through multiple molecular mechanisms that collectively amplify the apoptotic response. As a plasma membrane protein, PERP may directly alter membrane permeability or engage with death receptor signaling pathways . One significant mechanism involves a positive feedback loop in which PERP expression enhances p53 activity and stability. Studies using fluorescent fusion proteins have demonstrated that PERP expression significantly increases p53's nuclear localization and transcriptional activity in living cells . Additionally, PERP expression promotes phosphorylation of specific p53 serine residues that interfere with the interaction between p53 and its negative regulator MDM2 . This phosphorylation simultaneously stabilizes p53 and enhances its ability to activate pro-apoptotic gene transcription, creating a self-reinforcing circuit that drives cells toward apoptosis . Furthermore, PERP expression allows oscillatory nucleo-cytoplasmic shuttling of p53/MDM2 complexes, which may contribute to the spatial regulation of p53 activity . The combined effect of these mechanisms is a robust amplification of functional p53 levels that promote p53-dependent apoptosis in response to cellular stress signals.

How does PERP expression differ between apoptotic and cell cycle arrest conditions?

PERP exhibits a distinctive expression pattern that differentiates it from many other p53 target genes. While genes like p21 are induced to similar levels during both cell cycle arrest and apoptosis, PERP is expressed at significantly higher levels specifically in cells undergoing apoptosis . This differential expression has been observed in multiple experimental systems. In mouse embryonic fibroblasts (MEFs), PERP mRNA is robustly induced following DNA damage in E1A-expressing cells that undergo apoptosis, but shows minimal induction in wild-type MEFs that undergo G1 arrest . Time course analyses have revealed that PERP expression increases progressively during apoptosis, correlating with the onset of cell death . The molecular basis for this selective expression pattern lies in the differential binding of p53 to PERP response elements. Chromatin immunoprecipitation studies have shown that p53 occupies PERP response elements in vivo in E1A-expressing MEFs undergoing apoptosis but not in cells undergoing cell cycle arrest . In contrast, p53 binds to the p21 response element under both conditions . This selective binding provides a mechanistic explanation for PERP's preferential expression during apoptosis and highlights its specialized role in the apoptotic program.

What is the relationship between PERP and other pro-apoptotic p53 target genes?

PERP functions within a complex network of pro-apoptotic p53 target genes, each contributing distinctly to the apoptotic process. Unlike many p53 targets that operate primarily in the mitochondrial apoptotic pathway (such as PUMA, NOXA, and BAX) or function as death receptors (like FAS/APO1), PERP represents a unique class of p53 apoptotic effectors as a tetraspan membrane protein . Research suggests that PERP may cooperate with other p53 targets in a complementary fashion, with each protein targeting different cellular compartments or processes. For instance, while mitochondrial pathway proteins focus on cytochrome c release and caspase activation, PERP's plasma membrane localization suggests it may influence membrane integrity or signal transduction at the cell surface . The temporal expression patterns of these genes may also differ, with some serving as early initiators and others as downstream effectors. Importantly, the relative contribution of each pro-apoptotic target likely varies depending on cell type and stress stimulus. In some contexts, loss of PERP alone is sufficient to significantly impair apoptosis, while in others, multiple pro-apoptotic factors must be inactivated to prevent cell death, indicating functional redundancy within the p53 apoptotic network .

How can differential PERP binding by p53 be exploited for targeted cancer therapies?

The differential binding of p53 to PERP versus other target genes presents a promising avenue for developing targeted cancer therapies that selectively reactivate the apoptotic function of p53 while minimizing side effects. Research has shown that the apoptosis-deficient p53 point mutant, p53V143A, displays a selective deficit in binding to PERP response elements while maintaining binding to p21 elements . This suggests that the p53-PERP binding interface has unique characteristics that could be targeted by small molecules or peptides. A therapeutic approach could involve high-throughput screening of compound libraries to identify molecules that specifically enhance p53 binding to PERP response elements in tumor cells. Additionally, understanding the structural determinants that govern the selective occupation of PERP response elements during apoptosis could guide the design of chimeric transcription factors that preferentially activate PERP and other pro-apoptotic genes. For tumors with downregulated PERP expression, direct delivery of recombinant PERP or PERP-expressing vectors could bypass the need for p53 activation altogether. The discovery that PERP expression positively influences p53 activity through a feedback loop suggests that therapies enhancing PERP expression might amplify p53-dependent apoptosis specifically in cancer cells while sparing normal tissues with intact cell cycle checkpoints.

How does PERP interact with the PMP-22/gas3 tetraspan membrane protein family in different cellular contexts?

PERP shares sequence similarity with the PMP-22/gas3 tetraspan membrane protein family, which is implicated in hereditary human neuropathies such as Charcot–Marie–Tooth disease . While both PERP and PMP-22/gas3 are tetraspan membrane proteins with similar structural features, their interactions and functional relationships in different cellular contexts represent an intriguing area of ongoing research. In neural tissues, PMP-22/gas3 is essential for proper myelin formation and maintenance, with mutations leading to demyelinating neuropathies. PERP, while not primarily associated with neural function, may share some mechanistic similarities with PMP-22/gas3 in how it affects membrane integrity and cellular processes. Both proteins can induce cell death when overexpressed , suggesting common downstream pathways. In epithelial tissues, PERP plays crucial roles in development and homeostasis, with its loss associated with epithelial cancers. The potential functional overlap or compensation between PERP and other PMP-22/gas3 family members in these contexts remains largely unexplored. Research using co-immunoprecipitation, proximity ligation assays, and advanced imaging techniques could elucidate whether PERP physically interacts with PMP-22/gas3 family members or forms distinct complexes. Furthermore, comparative proteomic analyses of PERP and PMP-22/gas3 interactomes across different cell types would provide valuable insights into their context-specific functions and potential collaborative or antagonistic relationships.

What are the key considerations when designing experiments to study PERP-mediated apoptosis?

Designing robust experiments to study PERP-mediated apoptosis requires careful consideration of several key factors. First, cell type selection is crucial, as PERP's effects may vary significantly between different cellular contexts. Mouse embryonic fibroblasts (MEFs) have been extensively used as they can be manipulated to undergo either cell cycle arrest or apoptosis depending on their genetic background (e.g., wild-type versus E1A-expressing) . Second, the method of p53 activation should be carefully chosen, as different stressors (DNA damage, oncogene activation, hypoxia) may result in varying levels of PERP induction. Third, appropriate timing of measurements is essential, as PERP expression and apoptotic events follow specific kinetics that must be captured through time course analyses . Fourth, comprehensive apoptosis assessment using multiple complementary assays (Annexin V staining, TUNEL assay, caspase activation, mitochondrial membrane potential) provides more reliable results than single-endpoint measurements. Fifth, proper controls are critical, including p53-null cells to confirm p53 dependence and comparison with cells undergoing p53-dependent cell cycle arrest to verify PERP's apoptosis-specific induction . Finally, researchers should consider using both gain-of-function (PERP overexpression) and loss-of-function (PERP knockdown/knockout) approaches to comprehensively characterize PERP's role, while being mindful of potential compensation by other pro-apoptotic pathways in knockout models.

How can researchers effectively differentiate between the direct and indirect effects of PERP on apoptosis?

Differentiating between direct and indirect effects of PERP on apoptosis presents a significant methodological challenge that requires a multi-faceted experimental approach. One effective strategy employs temporally controlled expression systems, such as tetracycline-inducible promoters, to activate PERP expression at precise timepoints and monitor the subsequent cellular events with high temporal resolution. This approach can reveal whether apoptotic processes are initiated immediately following PERP expression (suggesting direct effects) or after a delay (indicating indirect mechanisms) . Another crucial method involves structure-function analyses using PERP mutants with specific domains altered or deleted. These studies can identify the structural elements essential for PERP's pro-apoptotic function and distinguish them from regions required for indirect effects such as p53 stabilization . Researchers should also utilize specific inhibitors of different apoptotic pathways (e.g., caspase inhibitors, mitochondrial permeability transition inhibitors) to determine which processes are necessary for PERP-induced cell death. Proximity labeling techniques like BioID or APEX2 can identify proteins that directly interact with PERP at the plasma membrane, providing insights into its immediate effector mechanisms . Finally, comparative analyses between wild-type PERP and a catalytically inactive mutant (if enzymatic activity is suspected) can help distinguish between scaffold/structural functions and enzymatic roles in apoptosis induction.

What are the most recent technological advances for studying PERP's membrane dynamics during apoptosis?

Recent technological advances have significantly enhanced our ability to study PERP's membrane dynamics during apoptosis with unprecedented spatial and temporal resolution. Super-resolution microscopy techniques, including Stimulated Emission Depletion (STED) microscopy, Stochastic Optical Reconstruction Microscopy (STORM), and Photoactivated Localization Microscopy (PALM), now enable visualization of PERP distribution within the plasma membrane at nanoscale resolution, revealing potential clustering or association with specific membrane microdomains during apoptosis initiation . Fluorescence Resonance Energy Transfer (FRET) and Fluorescence Recovery After Photobleaching (FRAP) methodologies provide valuable insights into PERP's membrane mobility and interactions with other proteins in living cells. These approaches have been successfully applied to study fluorescent fusion proteins of PERP, p53, and MDM2, demonstrating how PERP expression affects p53 localization and shuttling dynamics . Advanced mass spectrometry-based lipidomics now allows researchers to determine whether PERP expression alters membrane lipid composition, potentially identifying lipid changes that facilitate apoptotic membrane events. Cryo-electron microscopy and tomography offer structural insights into how PERP is arranged within membranes and whether it forms pores or alters membrane curvature during apoptosis. Finally, optogenetic tools for spatiotemporally controlled activation of PERP or its binding partners enable precise manipulation of PERP function in specific subcellular regions, providing causal evidence for its role in membrane-associated apoptotic processes.

How can PERP expression patterns be utilized as biomarkers in cancer diagnosis and prognosis?

PERP expression patterns hold significant potential as biomarkers for cancer diagnosis and prognosis, particularly given its established role in p53-dependent apoptosis and its observed downregulation in aggressive cancers such as monosomy 3-type uveal melanoma . To develop PERP-based biomarkers, researchers should conduct comprehensive analyses of PERP expression across diverse cancer types and correlate expression levels with clinical outcomes. This would involve immunohistochemical staining of tumor tissue microarrays, quantitative PCR measurement of PERP mRNA, and assessment of PERP protein levels through Western blotting or ELISA-based methods. Decreased PERP expression would likely indicate compromised apoptotic capacity and potentially more aggressive disease. Because PERP is a direct transcriptional target of p53, analysis of PERP expression in conjunction with p53 status could provide insights into the functional integrity of the p53 pathway, even in tumors with wild-type p53. This integrated approach might identify cases where p53 signaling is impaired despite the absence of mutations in the p53 gene itself. Furthermore, changes in PERP subcellular localization (e.g., from membrane to cytoplasmic) might serve as indicators of altered function even when expression levels remain unchanged. Longitudinal studies tracking PERP expression during disease progression and in response to therapy could establish its value as a dynamic biomarker reflecting treatment efficacy or emerging resistance.

What therapeutic strategies could target the PERP pathway in p53-mutated cancers?

Developing therapeutic strategies targeting the PERP pathway in p53-mutated cancers requires approaches that either bypass the need for functional p53 or restore the activity of mutant p53. One promising strategy involves direct activation of PERP expression independent of p53, potentially through identification and targeting of alternative transcription factors capable of binding to the PERP promoter . High-throughput screening could identify small molecules that directly induce PERP expression or enhance the activity of these alternative transcription factors. Another approach focuses on developing PERP mimetics—synthetic peptides or small molecules that mimic the pro-apoptotic function of PERP at the plasma membrane. These mimetics could potentially restore apoptotic capacity in cancer cells with dysfunctional p53 pathways. For cancers with specific p53 mutations that affect PERP binding while preserving other functions (such as p53V143A ), structure-based drug design could yield compounds that stabilize the interaction between mutant p53 and PERP response elements. Additionally, gene therapy approaches delivering PERP-expressing vectors directly to tumor cells could reestablish pro-apoptotic pathways. Given PERP's role in amplifying p53 activity , combination therapies pairing PERP pathway activation with existing treatments that induce cellular stress (chemotherapy, radiation) might enhance therapeutic efficacy even in p53-mutated cancers by maximizing the activity of any remaining functional p53 or p53 family members like p63 or p73.

How does PERP function in non-cancer pathologies and developmental processes?

PERP's functions extend beyond cancer to various non-cancer pathologies and developmental processes, particularly in tissues where cell adhesion, membrane integrity, and regulated apoptosis are crucial. In skin development and homeostasis, PERP plays essential roles, with its loss potentially contributing to skin disorders and compromised epithelial barrier function . As a tetraspan membrane protein with structural similarity to PMP-22/gas3—a protein implicated in hereditary neuropathies like Charcot–Marie–Tooth disease —PERP may have parallel functions in neural tissues that remain incompletely characterized. Investigation of PERP's role in these contexts requires tissue-specific knockout models and detailed morphological, functional, and molecular analyses. Researchers should examine embryonic development in PERP-null mice, focusing on tissues with high PERP expression, to identify developmental abnormalities. In adult tissues, conditional knockout models can reveal PERP's functions in tissue maintenance and repair following injury. For potential neurological roles, electrophysiological studies combined with ultrastructural analysis of myelin integrity in peripheral nerves would be informative. Additionally, given PERP's membrane localization, its potential involvement in cell-cell adhesion and tissue architecture should be investigated through cell aggregation assays, measurement of transepithelial/transendothelial electrical resistance, and analysis of junction protein complexes. Finally, since regulated apoptosis is crucial for immune system function, PERP's role in lymphocyte development, selection, and homeostasis represents another important area for investigation.

Comparative Analysis of PERP Expression in Different Experimental Conditions

Experimental ConditionPERP mRNA Expressionp53 Binding to PERP ElementsApoptotic OutcomeReference
Wild-type MEFs + DNA damageLowNot detectedG1 arrest
E1A-expressing MEFs + DNA damageHighDetectedApoptosis
p53-null MEFs + DNA damageNot detectedNot detectedNo response
p53V143A mutant MEFs + DNA damageLowNot detectedImpaired apoptosis
p53 Gln25Ser26 mutant cells + DNA damageNot detectedNot testedImpaired apoptosis
PERP overexpression in fibroblastsN/A (exogenous)N/AApoptosis
Uveal melanoma cells + increased PERPN/A (exogenous)Enhanced p53 activityEnhanced apoptosis

This table summarizes the relationship between PERP expression, p53 binding to PERP regulatory elements, and apoptotic outcomes across different experimental conditions. The data highlight PERP's specific induction during apoptosis rather than cell cycle arrest, and demonstrate how various p53 mutations differentially affect PERP expression and subsequent cellular responses.

Molecular Mechanisms of PERP-Mediated Enhancement of p53 Activity

PERP not only functions as a downstream effector of p53 but also enhances p53 activity through several mechanisms, creating a positive feedback loop. Using fluorescent fusion proteins of PERP, p53, and MDM2 in living uveal melanoma cells, researchers have elucidated the following key mechanisms :

  • Enhanced Nuclear Localization: PERP expression significantly increases p53 localization to the nucleus, where it can access and activate target gene promoters.

  • Increased Transcriptional Activity: PERP expression leads to enhanced p53-dependent transcription, including that of MDM2 and other target genes.

  • Regulated Protein Shuttling: Despite increased MDM2 expression, PERP allows oscillatory nucleo-cytoplasmic shuttling of p53/MDM2 complexes, maintaining dynamic p53 regulation.

  • Post-translational Modifications: PERP expression promotes phosphorylation of p53 serine residues that interfere with the p53-MDM2 interaction, stabilizing p53 protein.

  • Enhanced Pro-apoptotic Transcription: The phosphorylation induced by PERP specifically enhances p53's ability to activate pro-apoptotic gene transcription.

These findings collectively demonstrate how PERP amplifies functional p53 levels, creating a self-reinforcing circuit that drives cells toward apoptosis and providing a potential target for therapeutic intervention in cancers with intact p53 pathways.

Differential Binding of p53 to Target Gene Response Elements

p53 Target GeneResponse Element LocationOccupied During G1 ArrestOccupied During ApoptosisBinding by p53V143A MutantFunction
PERPPromoter and first intron (at least three sites)NoYesNoApoptosis
p215' regulatory regionYesYesYesCell cycle arrest
MDM2PromoterYesYesYesp53 regulation
PUMAPromoterPartialYesNot testedApoptosis
NOXAPromoterPartialYesNot testedApoptosis

This table illustrates the differential binding patterns of p53 to response elements of various target genes under different cellular conditions. The selective occupation of PERP elements specifically during apoptosis but not cell cycle arrest provides a mechanistic explanation for PERP's preferential expression during apoptotic responses . Furthermore, the apoptosis-deficient p53V143A mutant displays a selective deficit in binding to PERP elements while maintaining binding to p21 elements, demonstrating that p53 can distinguish between target genes at the level of DNA binding . These findings provide crucial insights into how p53 selectively activates specific gene sets depending on the cellular context and the signals received.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.