Recombinant Mouse Palmitoyltransferase ZDHHC13 (Zdhhc13)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Palmitoyltransferase ZDHHC13 (Zdhhc13)

Recombinant Mouse Palmitoyltransferase ZDHHC13 (Zdhhc13) is a zinc finger DHHC-type palmitoyltransferase enzyme responsible for post-translational S-palmitoylation of protein targets. This modification involves the covalent attachment of a 16-carbon palmitate group to cysteine residues, regulating protein localization, stability, and function. Zdhhc13 belongs to the DHHC-PAT family, characterized by a conserved DHHC (Asp-His-His-Cys) catalytic motif and zinc-binding domains . Its dysfunction has been linked to severe phenotypes in mice, including neurological deficits, osteoporosis, and systemic amyloidosis, underscoring its critical role in tissue homeostasis .

Key Substrates and Functional Roles

Zdhhc13 palmitoylates diverse proteins involved in mitochondrial function, lipid metabolism, and cellular signaling. Confirmed substrates include:

SubstrateFunctionImpact of Zdhhc13 DeficiencyReferences
Drp1Mitochondrial fission/fusion dynamicsAltered mitochondrial morphology, reduced ATP production, lactic acidosis
MT1-MMPExtracellular matrix remodeling and bone developmentOsteoporosis, delayed ossification, reduced VEGF/osteocalcin
MCATMitochondrial fatty acid synthesisImpaired mitochondrial fatty acid metabolism
CTNND1Adipogenesis regulationDysregulated lipid metabolism, hypermetabolism

Neurological and Mitochondrial Dysfunction

Zdhhc13-deficient mice (luc) exhibit:

  1. Behavioral Deficits: Increased sensorimotor gating, anxiety, and hypoactivity .

  2. Mitochondrial Dysregulation: Reduced Drp1 palmitoylation, disrupted fission-fusion balance, and elevated glycolysis/glutaminolysis .

  3. Neurotransmitter Imbalances: Altered synaptic integrity and neurotransmitter levels .

Skeletal Abnormalities

In Zdhhc13-mutant mice:

  • Osteoporosis: Reduced bone mineral density, disorganized growth plates, and delayed ossification .

  • Mechanism: Impaired MT1-MMP palmitoylation, leading to decreased VEGF and osteocalcin expression .

Hepatic and Metabolic Disorders

Liver-specific studies reveal:

  • Lipid Metabolism: Downregulation of 400 S-palmitoylated proteins, including MCAT and CTNND1, causing hypermetabolism and lipid abnormalities .

  • Mitochondrial Dysfunction: Impaired electron transport chain (ETC) proteins (e.g., SDHA, NDUFV1), leading to energy deficits .

Disease Implications and Therapeutic Potential

DiseaseAssociation with Zdhhc13References
Huntington’s DiseaseZdhhc13 interacts with huntingtin (Htt); its deficiency exacerbates Htt aggregation and motor deficits
OsteoporosisMT1-MMP palmitoylation defects reduce bone matrix remodeling and mineralization
AmyloidosisSystemic amyloid deposition in liver and kidney, linked to altered protein folding/stability
Skin CarcinogenesisAlopecia and epidermal hyperplasia in mutant mice, increasing cancer susceptibility

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development with the specified tag.
Synonyms
Zdhhc13; Hip14l; Palmitoyltransferase ZDHHC13; Huntingtin-interacting protein 14-related protein; HIP14-related protein; Zinc finger DHHC domain-containing protein 13; DHHC-13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-622
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Zdhhc13
Target Protein Sequence
MEGPGLGSQCRNHSHGSHVPGFGRHGICVHENKELAKAKEILPLIEDSSNCDIVKATQYG IFERCKELVEAGYDVRQPDRENVSLLHWAAINNRLELVKFYISKGAVIDQLGGDLNSTPL HWAIRQGHLPMVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDV NGQTPLMLSAYKVIGPEPTGFLLKFNPSLSVVDKTHQNTPLHWAVAAGNVSAVDKLLEAG SSLDIRNAKGETPLDMALQSKNQLISHMLRTEAKMRANKQFRLWRWLHKCELFLLLILSM ITLWAVGYILDFNSDSWLLKGCLLVALFFLTSLFPRFLVGYKNLVYLPTVFLLSSIFWIF MTWFILFFPDTAGSPLYFAFIFSIMAFLYFFYKTWATDPGFTKASEEERKVNIVTLAETG SLDFRTFCTSCLIRKPLRSLHCHVCNSCVARFDQHCFWTGRCIGFGNHHHYIFFLLSLSM VCDWIIYGSFVYWSNHCATTFKEDGLWTYLNQIVACSPWVLYIFMLAAFHFSWSTFLLIN QLFQIAFLGLTSHERISLLKQSRHMKQTLSLRKTPYNLGFTQNLADFFQCGCFGLVKPCI IDWTSQYTMVFHPAKEKVLRSV
Uniprot No.

Target Background

Function
Palmitoyltransferase that catalyzes the addition of palmitate onto various protein substrates. It functions as a palmitoyltransferase for HTT and GAD2 and may play a role in Mg(2+) transport.
Gene References Into Functions
  1. The loss of ZDDHC13 in skin impairs multiple barrier functions, leading to a dermatitis lesion in response to microbial encounters. PMID: 28017833
  2. Homozygous Zdhhc13luc/Zdhhc13luc mice exhibit generalized hypotrichosis, associated with abnormal hair cycle, epidermal and sebaceous gland hyperplasia, hyperkeratosis, and increased epidermal thickness PMID: 26288350
  3. Research indicates that the ankyrin repeat (AR) domains of S-acyltransferases zDHHC17 and zDHHC13 recognize peptide sequences in several unrelated proteins. PMID: 26198635
  4. Zdhhc13 regulates Smad6 during BMP-dependent signaling and early lineage decisions in an in vitro cell model. PMID: 24702307
  5. Loss of Hip14 and Hip14l leads to early embryonic lethality at embryonic day 10-11 due to failed chorioallantoic fusion. PMID: 25478910
  6. Zdhhc13 serves as a novel regulator of postnatal skeletal development and bone mass acquisition. PMID: 24637783
  7. Hip14l-deficient mice develop adult-onset, neuropathological deficits characteristic of Huntington disease. PMID: 23077216
  8. A second gene trap allele of Zdhhc13 exhibits the same phenotypes, suggesting a loss of function allele. PMID: 20548961
  9. huntingtin interacting protein genes, HIP14 and HIP14L, encode Mg2+ transport proteins that are regulated by their innate palmitoyl acyltransferases, fulfilling the characteristics of "chanzymes." PMID: 18794299

Show More

Hide All

Database Links
Protein Families
DHHC palmitoyltransferase family, AKR/ZDHHC17 subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in most adult tissues, but at low levels in the liver, skin, and lung.

Q&A

What is ZDHHC13 and what is its role in cellular biology?

ZDHHC13, also known as HIP14L or DHHC13, is a 622 amino acid protein that contains one DHHC-type zinc finger and six ANK repeats. It belongs to the DHHC palmitoyltransferase family and is primarily localized in the Golgi apparatus membrane. ZDHHC13 functions as a palmitoyltransferase, catalyzing the addition of palmitate (a 16-carbon fatty acid) to specific protein substrates through a process called S-palmitoylation . This post-translational modification affects protein localization, stability, and function, with significant implications for cellular processes including mitochondrial dynamics, neurotransmission, and synaptic structure integrity .

How does ZDHHC13 differ from other members of the DHHC palmitoyltransferase family?

ZDHHC13 is one of 23 (human) or 24 (mouse and rat) DHHC-domain-containing proteins that function as palmitoyl acyltransferases (PATs). While all members of this family share a common catalytic DHHC domain and utilize palmitoyl CoA as a substrate, ZDHHC13 has distinct substrate specificity and cellular functions . Unlike some other family members such as ZDHHC17, which has been extensively studied for its role in neurogenesis and neurotransmission, ZDHHC13 has unique implications in mitochondrial function, particularly through its interaction with and palmitoylation of Drp1, a key regulator of mitochondrial fission . Additionally, ZDHHC13 deficiency has been specifically linked to alopecia, amyloidosis, osteoporosis, and behavioral deficits, indicating its unique physiological roles compared to other family members .

What are the known substrates of ZDHHC13?

Through various biochemical and functional studies, several proteins have been identified as substrates of ZDHHC13. The most well-characterized substrate is Drp1 (Dynamin-related protein 1), a GTPase that regulates mitochondrial fission. Direct protein-protein interaction between ZDHHC13 and Drp1 has been confirmed both in vitro and in vivo, establishing Drp1 as a bona fide substrate of ZDHHC13 . Huntingtin (Htt) is another confirmed substrate, with implications for Huntington's disease pathology. ZDHHC13-dependent S-palmitoylation of Htt affects its function and may contribute to neurological phenotypes observed in ZDHHC13-deficient models . Additionally, several mitochondrial proteins involved in intermediary metabolism have been shown to be S-palmitoylated, potentially by ZDHHC13, though specific enzyme-substrate relationships require further validation .

What are the recommended methods for detecting ZDHHC13 expression and activity?

For detecting ZDHHC13 expression at the protein level, Western Blot (WB) is recommended using validated antibodies such as the 24759-1-AP polyclonal antibody at dilutions of 1:500-1:2000 . This antibody has been tested in mouse kidney tissue, HEK-293 cells, mouse skin tissue, mouse testis tissue, and Neuro-2a cells . For cellular localization studies, immunofluorescence (IF) or immunocytochemistry (ICC) can be performed using dilutions of 1:20-1:200 of the same antibody .

For assessing ZDHHC13 enzymatic activity, the acyl-biotin exchange (ABE) assay is the gold standard. This method involves replacing palmitoyl modifications with biotin, allowing for the detection and quantification of palmitoylated proteins . When comparing samples from wild-type and ZDHHC13-deficient models, significant differences in palmitoylation patterns of specific proteins (particularly in the 45-50 kDa range) indicate ZDHHC13-dependent palmitoylation . For a more targeted approach to identify specific ZDHHC13 substrates, co-immunoprecipitation followed by mass spectrometry can be employed to detect protein-protein interactions and subsequent palmitoylation events.

ApplicationRecommended MethodDilution/Protocol
Protein ExpressionWestern Blot1:500-1:2000
Cellular LocalizationIF/ICC1:20-1:200
Enzymatic ActivityAcyl-Biotin ExchangeStandard protocol
Substrate IdentificationCo-IP with Mass SpecExperiment-specific

How can researchers generate and validate ZDHHC13-deficient experimental models?

Several approaches can be used to generate ZDHHC13-deficient models for research:

  • Natural mutation models: The luc mice model carries a naturally occurring recessive mutation in Zdhhc13 resulting in a premature stop codon (L203X) . This model shows reduced Zdhhc13 expression (>50% reduction) in various tissues including skin, brain, and lungs compared to wild-type mice .

  • Knockout models: Complete knockout models can be generated through CRISPR-Cas9 technology or traditional gene targeting approaches. Validation of these models should include confirmation of gene disruption at the DNA level and reduced protein expression through Western blotting .

  • RNA interference: For in vitro studies, siRNA or shRNA targeting ZDHHC13 can be used to achieve transient or stable knockdown, respectively.

Validation of these models should include:

  • Genotyping to confirm genetic alterations

  • qRT-PCR to measure mRNA expression levels

  • Western blotting to confirm reduced protein expression

  • ABE assay to demonstrate decreased palmitoylation of known ZDHHC13 substrates, particularly Drp1

  • Phenotypic analysis including assessment of skin abnormalities (alopecia) and behavioral tests (for brain-related phenotypes)

What experimental approaches can identify novel ZDHHC13 substrates?

Identifying novel substrates of ZDHHC13 requires specialized techniques that can distinguish ZDHHC13-dependent palmitoylation from modifications catalyzed by other DHHC family members. Several approaches are recommended:

  • Orthogonal enzyme-substrate design strategy: This innovative approach involves engineering orthogonal enzyme-substrate pairs through the use of synthetic fatty acyl CoA analogues that can be utilized selectively by mutant ZDHHC enzymes but not by wild-type enzymes . Specifically, synthetic analogues containing bulky aromatic substituents at the termini of the acyl chain can be paired with ZDHHC20 mutants (such as Y181A or C182F) . This strategy has successfully identified both known and novel substrates for related enzymes and could be adapted for ZDHHC13 .

  • Comparative palmitoylation profiling: Using techniques such as acyl-biotin exchange (ABE) or metabolic labeling with clickable palmitate analogues (e.g., 17-octadecynoic acid), researchers can compare the palmitoylome of wild-type and ZDHHC13-deficient cells or tissues. Proteins showing decreased palmitoylation in the absence of ZDHHC13 represent potential substrates .

  • Proximity-based labeling: BioID or APEX2 fused to ZDHHC13 can be used to biotinylate proteins in close proximity to ZDHHC13 in live cells, potentially identifying transient enzyme-substrate interactions.

  • Direct binding assays: Co-immunoprecipitation followed by mass spectrometry can identify proteins that physically interact with ZDHHC13, many of which may be substrates.

  • In vitro palmitoylation assays: Recombinant ZDHHC13 can be used in cell-free systems to test palmitoylation of candidate substrates, confirming direct enzyme-substrate relationships.

How does ZDHHC13 deficiency affect brain function and behavior?

ZDHHC13 deficiency has significant impacts on brain function and behavior, as demonstrated in mouse models. At 3 months of age, Zdhhc13-deficient mice display increased sensorimotor gating, anxiety, hypoactivity, and decreased motor coordination compared to littermate controls . These behavioral abnormalities appear to be mechanistically linked to altered mitochondrial dynamics and function in the brain.

Specific behavioral phenotypes include:

  • Increased anxiety-related behavior, as measured by open field tests

  • Motor coordination deficits, demonstrated by poorer performance on rotarod tests and abnormal gait patterns including shorter limb swing times, broader track width, and increased print area for left limbs

  • Altered sensorimotor gating, suggesting potential disturbances in information processing

These behavioral deficits are consistent with the high expression of Zdhhc13 in the cerebellum relative to other brain regions and correlate with the critical role of palmitoylation in neuronal function . The importance of ZDHHC13 in brain function is further supported by the observation that its deficiency results in neurotransmitter imbalances, which likely contribute to the observed behavioral phenotypes .

What is the relationship between ZDHHC13 and mitochondrial dynamics in neurons?

ZDHHC13 plays a crucial role in regulating mitochondrial dynamics in neurons through its palmitoylation of Drp1 (Dynamin-related protein 1), a key mediator of mitochondrial fission . S-palmitoylation of Drp1 by ZDHHC13 is essential for normal mitochondrial fission-fusion processes, which maintain mitochondrial morphology, distribution, and function .

In ZDHHC13-deficient models, decreased Drp1 palmitoylation leads to:

  • Altered mitochondrial morphology and distribution

  • Disrupted mitochondrial fission-fusion balance

  • Compromised mitochondrial ATP production

  • Increased reliance on glycolysis and glutaminolysis, resulting in lactic acidosis

  • Changes in neurotransmitter metabolism and signaling

Direct interaction between ZDHHC13 and Drp1 has been confirmed both in vitro and in vivo, establishing Drp1 as a bona fide substrate of ZDHHC13 . This relationship is particularly significant in highly aerobic tissues such as the brain, where mitochondrial dysfunction can have profound effects on energy metabolism and neuronal function .

The metabolic consequences of this disruption are evidenced by untargeted metabolomics of cerebellum from ZDHHC13-deficient mice, which revealed significant alterations in 18 metabolites, with 67% being more abundant in homozygous mutants compared to wild-type mice . Notably, the lactate-to-pyruvate ratio was increased, indicating a shift towards aerobic glycolysis and suggesting compensatory metabolic adaptations in response to compromised oxidative phosphorylation .

What are the implications of ZDHHC13 research for understanding neurodegenerative diseases?

Research on ZDHHC13 has significant implications for understanding the pathophysiology of neurodegenerative diseases, particularly Huntington's disease (HD) . The ZDHHC13 knockout mouse model developed by Dr. Hayden's group exhibits behavioral phenotypes consistent with HD, suggesting a mechanistic link between ZDHHC13 deficiency and HD pathology . This connection is supported by the finding that Huntingtin (Htt) is a substrate for ZDHHC13-mediated palmitoylation, and reduced Htt palmitoylation has been observed in ZDHHC13-deficient models .

Beyond HD, ZDHHC13 research has broader implications for understanding other neurodegenerative conditions characterized by mitochondrial dysfunction, which is a common feature in diseases such as Parkinson's disease, Alzheimer's disease, and amyotrophic lateral sclerosis. The critical role of ZDHHC13 in maintaining mitochondrial dynamics through Drp1 palmitoylation suggests that dysregulation of this post-translational modification could contribute to mitochondrial pathology in various neurodegenerative contexts .

Furthermore, the behavioral phenotypes observed in ZDHHC13-deficient models, including anxiety and motor coordination deficits, overlap with symptoms seen in various neurological and psychiatric disorders . This suggests that alterations in palmitoylation-dependent processes could contribute to a broader range of neuropsychiatric conditions than previously recognized.

How can researchers leverage orthogonal enzyme-substrate systems for ZDHHC13 studies?

The orthogonal enzyme-substrate design strategy represents a powerful approach for studying specific ZDHHC enzymes like ZDHHC13 in complex biological systems . This method addresses the challenge of substrate specificity that arises from the shared catalytic mechanism and common substrate (palmitoyl CoA) used by all DHHC family members .

To implement this strategy for ZDHHC13 studies, researchers should:

  • Design synthetic fatty acyl CoA analogues: Create analogues with structural modifications that prevent their utilization by wild-type enzymes while allowing recognition by engineered ZDHHC13 variants. Studies with ZDHHC20 have shown that analogues containing bulky aromatic substituents at the termini of the acyl chain can achieve this selectivity .

  • Engineer ZDHHC13 mutants: Based on structural insights, modify the fatty acyl-binding cavity of ZDHHC13 to accommodate the synthetic analogues. This may involve altering cavity-lining residues, similar to the Y181A and C182F mutations that proved successful for ZDHHC20 .

  • Validate orthogonality: Confirm that the engineered ZDHHC13 can utilize the synthetic analogue while the wild-type enzyme cannot, using autoacylation assays .

  • Perform substrate labeling experiments: Express the engineered ZDHHC13 in cellular systems and introduce the synthetic analogue to selectively label ZDHHC13 substrates. These can then be identified using click chemistry and mass spectrometry approaches .

This strategy enables precise identification of enzyme-specific substrates, offering advantages over traditional comparative approaches that may be confounded by compensatory effects or indirect consequences of enzyme deficiency. Additionally, it allows for temporal control of labeling, facilitating the study of dynamic palmitoylation events .

What are the current challenges in studying ZDHHC13 and potential solutions?

Studying ZDHHC13 presents several technical and conceptual challenges that researchers must address:

  • Substrate specificity overlap: ZDHHC family members often show overlapping substrate specificity, making it difficult to attribute palmitoylation of specific proteins solely to ZDHHC13 .

    • Solution: Utilize orthogonal enzyme-substrate systems as described above or combine multiple approaches (genetic models, in vitro assays, and direct binding studies) to establish enzyme-substrate relationships with high confidence .

  • Tissue-specific functions: ZDHHC13 may have different substrates and functions in different tissues, complicating the interpretation of whole-organism knockout models .

    • Solution: Develop tissue-specific conditional knockout models using Cre-lox technology to study ZDHHC13 function in specific contexts.

  • Compensatory mechanisms: Loss of ZDHHC13 may lead to compensatory upregulation of other DHHC family members, masking some phenotypes .

    • Solution: Perform comprehensive expression analysis of all DHHC family members in ZDHHC13-deficient models and consider acute depletion strategies (e.g., inducible knockdown) to minimize compensation.

  • Technical difficulties in palmitoylation detection: S-palmitoylation is labile and can be technically challenging to detect reliably .

    • Solution: Combine multiple complementary techniques (ABE, metabolic labeling, mass spectrometry) and include appropriate controls to ensure robust palmitoylation detection.

  • Distinguishing direct vs. indirect effects: It can be difficult to determine whether phenotypes in ZDHHC13-deficient models result directly from loss of specific protein palmitoylation or from downstream consequences .

    • Solution: Use substrate-specific approaches, such as generating palmitoylation-deficient mutants of individual substrates (e.g., Drp1) to compare phenotypes with those of ZDHHC13 deficiency.

How does ZDHHC13 research contribute to therapeutic development for mitochondrial and neurological disorders?

Research on ZDHHC13 offers several promising avenues for therapeutic development targeting mitochondrial and neurological disorders:

  • Target validation: The identification of Drp1 as a key substrate of ZDHHC13 with implications for mitochondrial dynamics provides a validated target for therapeutic intervention in diseases characterized by abnormal mitochondrial fission-fusion balance . Modulating Drp1 palmitoylation could potentially normalize mitochondrial dynamics in conditions where these processes are dysregulated.

  • Biomarker development: The metabolic changes observed in ZDHHC13-deficient models, including altered lactate-to-pyruvate ratios and changes in specific metabolites, could serve as biomarkers for monitoring disease progression or therapeutic response in related neurological conditions .

  • Drug discovery platforms: The orthogonal enzyme-substrate system developed for DHHC enzymes provides a platform for screening small molecules that could selectively modulate ZDHHC13 activity or mimic/inhibit specific palmitoylation events . This could lead to the development of targeted therapeutics with fewer off-target effects.

  • Personalized medicine approaches: Understanding how specific ZDHHC13 variants or expression levels correlate with disease phenotypes could inform personalized treatment strategies for patients with neurological disorders that involve palmitoylation defects.

  • Gene therapy potential: For conditions directly linked to ZDHHC13 deficiency, gene therapy approaches to restore ZDHHC13 function in affected tissues represent a potential therapeutic strategy, particularly for monogenic disorders associated with ZDHHC13 mutations.

Ongoing research characterizing the molecular mechanisms by which ZDHHC13-mediated palmitoylation influences mitochondrial function and neuronal health will continue to reveal new therapeutic targets and strategies for addressing a range of neurological and mitochondrial disorders .

What are the optimal conditions for expressing and purifying recombinant mouse ZDHHC13?

Expressing and purifying recombinant mouse ZDHHC13 presents unique challenges due to its multiple transmembrane domains and membrane localization. Based on established protocols for similar membrane proteins, the following conditions are recommended:

  • Expression systems:

    • Mammalian expression systems (HEK293 or CHO cells) are preferred for proper folding and post-translational modifications

    • Baculovirus-insect cell systems can provide higher yields while maintaining proper protein folding

    • Bacterial systems (E. coli) may be used for expressing soluble domains only

  • Expression constructs:

    • Use codon-optimized sequences for the expression system

    • Include affinity tags (His6, FLAG, or Strep) positioned to avoid interference with transmembrane domains

    • Consider fusion with maltose-binding protein (MBP) or glutathione S-transferase (GST) to enhance solubility

  • Purification conditions:

    • Solubilize membranes using gentle detergents such as n-dodecyl-β-D-maltoside (DDM), CHAPS, or digitonin

    • Include glycerol (10-15%) and reducing agents in all buffers

    • Purify using affinity chromatography followed by size exclusion chromatography

    • Maintain pH between 7.0-8.0 and include protease inhibitors throughout the purification process

  • Storage conditions:

    • Store at -80°C in buffer containing 10-15% glycerol

    • Avoid repeated freeze-thaw cycles

    • For long-term stability, consider reconstitution into nanodiscs or liposomes

How should researchers design activity assays for recombinant ZDHHC13?

Designing robust activity assays for recombinant ZDHHC13 requires careful consideration of its enzymatic properties and substrate specificity. The following approaches are recommended:

  • Autoacylation assays:

    • Incubate purified ZDHHC13 with radiolabeled palmitoyl-CoA ([³H]-palmitoyl-CoA) or clickable palmitate analogues

    • Detect autoacylation by SDS-PAGE followed by fluorography (for radiolabeled substrates) or click chemistry conjugation to fluorescent probes

    • Include controls with catalytically inactive ZDHHC13 (mutation in the DHHC motif)

  • Trans-palmitoylation assays:

    • Using confirmed substrates such as Drp1, measure transfer of palmitate from ZDHHC13 to substrate

    • Optimize substrate concentration, reaction time, and buffer conditions (pH 7.2-7.4, 1-5 mM MgCl₂, reducing environment)

    • Detect palmitoylation using ABE assay, radiolabeled palmitate, or clickable palmitate analogues

  • High-throughput screening assays:

    • Develop FRET-based assays using fluorescently labeled substrate peptides

    • Consider bioluminescence-based approaches with modified acyl-CoA donors

    • Adapt biochemical assays to microplate format for screening inhibitors or enhancers

  • Key assay parameters to optimize:

    • Enzyme:substrate ratio (typically 1:10 to 1:100)

    • Reaction temperature (commonly 25°C or 37°C)

    • Reaction time (5-60 minutes)

    • Buffer composition (particularly detergent type and concentration)

    • Presence of cofactors such as Zn²⁺

Assay TypeDetection MethodAdvantagesLimitations
AutoacylationRadiography or Click ChemistryDirect measure of enzyme activityDoes not assess trans-palmitoylation
Trans-palmitoylationABE or Metabolic LabelingMeasures physiologically relevant activityRequires pure substrate protein
FRET-basedFluorescenceSuitable for high-throughput screeningMay not reflect activity on full-length substrates

What controls and validation experiments are essential when using recombinant ZDHHC13 in research?

When using recombinant ZDHHC13 in research, several controls and validation experiments are essential to ensure reliable and interpretable results:

  • Activity controls:

    • Catalytic dead mutant: Include a DHHS mutant (C-to-S mutation in the DHHC motif) as a negative control in all activity assays

    • Known substrate: Include a well-established substrate (e.g., Drp1) as a positive control for palmitoylation activity

    • Hydroxylamine sensitivity: Confirm that the detected modification is removed by hydroxylamine treatment, verifying that it is indeed a thioester linkage characteristic of S-palmitoylation

  • Structural and biochemical validation:

    • Circular dichroism: Verify proper folding of the recombinant protein

    • Size exclusion chromatography: Confirm monodispersity and appropriate oligomeric state

    • Thermal shift assays: Assess protein stability under various conditions

    • Mass spectrometry: Verify protein identity and integrity

  • Substrate specificity validation:

    • Competitive assays: Demonstrate preference for specific substrates over others

    • Kinetic parameters: Determine Km and Vmax for various substrates to quantify specificity

    • Mutation studies: Show that substrate mutations at putative palmitoylation sites prevent modification

  • Cellular validation:

    • Rescue experiments: Demonstrate that recombinant ZDHHC13 can restore palmitoylation in ZDHHC13-deficient cells

    • Localization studies: Verify that recombinant ZDHHC13 localizes correctly to the Golgi apparatus when expressed in cells

    • Functional assays: Show that recombinant ZDHHC13 can rescue phenotypes in ZDHHC13-deficient models (e.g., mitochondrial morphology)

  • Orthogonal validation approaches:

    • Confirm key findings using multiple detection methods (ABE, metabolic labeling, mass spectrometry)

    • Validate in multiple cell types or experimental systems

    • Compare results with those obtained using alternative enzyme sources (e.g., cell lysates, microsomal fractions)

These controls and validation experiments are essential for establishing the reliability and specificity of findings derived from studies using recombinant ZDHHC13, particularly given the challenges associated with working with membrane-bound enzymes and the complexity of the palmitoylation landscape.

What are the most significant recent advances in ZDHHC13 research?

Recent advances in ZDHHC13 research have significantly expanded our understanding of this enzyme's role in cellular physiology and disease pathology. The identification of Drp1 as a key substrate of ZDHHC13 has established a direct mechanistic link between ZDHHC13-mediated palmitoylation and mitochondrial dynamics, with profound implications for brain function and behavior . This finding represents a paradigm shift in our understanding of how post-translational modifications regulate mitochondrial function, a critical process in highly aerobic tissues such as the brain .

Additionally, the development of orthogonal enzyme-substrate design strategies for DHHC palmitoyltransferases has opened new avenues for studying the specific functions of individual family members, including ZDHHC13 . This innovative approach enables precise identification of enzyme-specific substrates, overcoming the challenge of overlapping substrate specificity among DHHC family members . The successful application of this strategy to ZDHHC20 paves the way for similar approaches with ZDHHC13, potentially revealing new substrates and functions .

Furthermore, detailed behavioral and metabolic characterization of ZDHHC13-deficient mouse models has revealed unexpected roles for this enzyme in anxiety-related behaviors, motor coordination, and brain metabolism . The observation that ZDHHC13 deficiency leads to increased glycolysis, glutaminolysis, and lactic acidosis suggests a complex interplay between palmitoylation, mitochondrial function, and cellular metabolism that warrants further investigation .

What are promising future research directions for ZDHHC13?

Several promising research directions emerge from current knowledge about ZDHHC13:

  • Comprehensive substrate identification: Applying orthogonal enzyme-substrate strategies and other advanced proteomics approaches to comprehensively identify ZDHHC13-specific substrates across different tissues and developmental stages .

  • Structural biology investigations: Determining the three-dimensional structure of ZDHHC13, including substrate-bound conformations, to gain insights into its mechanism and substrate recognition. This could build upon the structural information available for related enzymes like ZDHHC20 .

  • Tissue-specific functions: Investigating the role of ZDHHC13 in specific tissues using conditional knockout models, with particular focus on highly aerobic tissues like brain, heart, and muscle where mitochondrial function is critical .

  • Developmental roles: Exploring the function of ZDHHC13 during embryonic and postnatal development, particularly in the context of neurogenesis and brain development.

  • Disease-focused investigations: Further characterizing the role of ZDHHC13 in neurodegenerative diseases, especially Huntington's disease, and investigating potential connections to other conditions characterized by mitochondrial dysfunction .

  • Therapeutic modulation: Developing small molecules or other approaches to modulate ZDHHC13 activity or mimic/block specific palmitoylation events, with potential therapeutic applications in neurological disorders .

  • Interplay with other post-translational modifications: Investigating how ZDHHC13-mediated palmitoylation interacts with other post-translational modifications (phosphorylation, ubiquitination, etc.) to form complex regulatory networks controlling protein function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.