Recombinant Mouse Palmitoyltransferase ZDHHC17 (Zdhhc17)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant mouse ZDHHC17 is synthesized using cell-free expression systems (e.g., E. coli, yeast, or mammalian cells) to ensure proper folding and post-translational modifications . Specifications include:

ParameterDetail
Host SystemsE. coli, yeast, baculovirus, or mammalian cells
Purity≥85% (verified by SDS-PAGE)
Applications- Western blot (WB)
- Immunohistochemistry (IHC)
- Enzyme activity assays (e.g., Smad7 palmitoylation)

Partial constructs (e.g., residues 1-300) are commonly used to study domain-specific interactions .

Role in Signaling Pathways

  • JNK/p38 Activation: ZDHHC17 recruits MAP2K4 via its ANK domain, forming a signaling module that enhances JNK/p38 phosphorylation in glioblastoma .

  • TGF-β Inhibition: ZDHHC17 palmitoylates Smad7 at Cys202, Cys225, Cys415, and Cys417, stabilizing Smad7 in the cytoplasm to suppress TGF-β signaling .

  • Inflammasome Regulation: ZDHHC17-mediated palmitoylation of NLRP3 promotes inflammasome assembly and IL-1β secretion in macrophages .

Disease Associations

  • Cancer: Overexpression drives tumorigenicity in glioma by activating MAPK pathways .

  • Neurodegeneration: Regulates huntingtin palmitoylation, with defects linked to Huntington’s disease .

  • Viral Infections: Identified as a host factor for swine acute diarrhea syndrome coronavirus (SADS-CoV) entry .

Applications in Research

Study TypeUtility of Recombinant ZDHHC17
Mechanistic Studies- Mapping ANK domain-substrate interactions (e.g., MAP2K4, Smad7)
Drug Discovery- Screening for inhibitors targeting DHHC catalytic activity
Structural Biology- Molecular docking studies (e.g., ZDHHC17-MAP2K4 complex)

Challenges and Future Directions

  • Substrate Specificity: ZDHHC17 interacts with >50 substrates (e.g., huntingtin, SNAP25) , necessitating high-purity recombinant protein to avoid off-target effects.

  • Therapeutic Targeting: Small-molecule inhibitors of ZDHHC17 could treat cancers or inflammatory diseases but require in-depth pharmacokinetic studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery details, please consult your local distributors.
Note: Our proteins are standardly shipped with blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Zdhhc17; Hip14; Kiaa0946; Palmitoyltransferase ZDHHC17; Acyltransferase ZDHHC17; DHHC domain-containing cysteine-rich protein 17; DHHC-17; Huntingtin-interacting protein 14; Zinc finger DHHC domain-containing protein 17
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-632
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Zdhhc17
Target Protein Sequence
MQREEGFNTKMADGPDEYETETGCVPLLHPEEIKPQSHYNHGYGEPLGRKTHIDDYSTWD IVKATQYGIYERCRELVEAGYDVRQPDKENVTLLHWAAINNRIDLVKYYISKGAIVDQLG GDLNSTPLHWATRQGHLSMVVQLMKYGADPSLIDGEGCSCIHLAAQFGHTSIVAYLIAKG QDVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVNLGDKYHKNTALHWAVLAGNTTV ISLLLEAGGNVDAQNVKGESALDLAKQRKNVWMINHLQEARQAKGYDNPSFLRKLKADKE FRQKVMLGTPFLVIWLVGFIADLDIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPL GIYLATKFWMYVTWFFWFWNDLNFLFIHLPFLANSVALFYNFGKSWKSDPGIIKATEEQK KKTIVELAETGSLDLSIFCSTCLIRKPVRSKHCGVCNRCIAKFDHHCPWVGNCVGAGNHR YFMGYLFFLLFMICWMIYGCVSYWGLHCETTYTKDGFWTYITQIATCSPWMFWMFLNSVF HFLWVAVLLMCQLYQITCLGITTNERMNARRYKHFKVTTTSIESPFNHGCVRNIIDFFEF RCCGLFRPVIVDWTRQYTIEYDQISGSGYQLV
Uniprot No.

Target Background

Function
Palmitoyltransferase, also known as ZDHHC17, catalyzes the attachment of palmitate to various protein substrates, playing a crucial role in diverse cellular processes. It exhibits broad fatty acid selectivity and can transfer myristate from tetradecanoyl-CoA and stearate from octadecanoyl-CoA to target proteins in addition to palmitate. ZDHHC17 is a palmitoyltransferase specifically targeting a subset of neuronal proteins including SNAP25, DLG4/PSD95, GAD2, SYT1, and HTT. It also palmitoylates neuronal proteins GPM6A, SPRED1, and SPRED3. Moreover, it may contribute to axonogenesis by regulating NTRK1 and the downstream ERK1/ERK2 signaling cascade. Potentially involved in sorting or targeting critical proteins associated with endocytosis initiation at the plasma membrane. ZDHHC17 might also play a role in Mg(2+) transport. Additionally, it can palmitoylate DNAJC5, influencing its localization to the Golgi membrane.
Gene References Into Functions
  1. These data indicate that HIP14 is essential for the maintenance of life and neuronal integrity in adult mice. PMID: 27927242
  2. This study identified ZDHHC17 as a significant upstream factor of ERK1/2 in regulating the interaction between TrkA and tubulin during neuronal development. PMID: 26232532
  3. In the absence of HIP14, striatal neurons become dysfunctional, leading to impaired motor behavior. PMID: 24376823
  4. The constitutive absence of Hip14/DHHC17 results in substantial neurophysiological deficits and associated cognitive dysfunction. PMID: 24277827
  5. Altered palmitoylation mediated by HIP14 may contribute to HD. PMID: 21775500
  6. Wild-type HTT modulates the enzymatic activity of the neuronal palmitoyl transferase HIP14. PMID: 21636527
  7. Immunohistochemical analysis of pancreatic sections revealed that HIP14 is primarily expressed in insulin-positive cells within the islets of Langerhans. PMID: 21705657
  8. Downregulation of HIP14 in mouse neurons expressing wild-type and mutant htt enhances inclusion formation, whereas overexpression of HIP14 significantly reduces inclusions. PMID: 16699508

Show More

Hide All

Database Links
Protein Families
DHHC palmitoyltransferase family, AKR/ZDHHC17 subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein. Cell junction, synapse, presynaptic cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in liver, testis, kidney, heart, pancreas and brain. Highest expression was seen in the brain. Localized predominantly in the perinuclear regions of neurons from the cortex, striatum and hippocampus. Colocalized with HTT in the medium spiny neur

Q&A

What is ZDHHC17 and what are its key structural characteristics?

ZDHHC17 (Zdhhc17), also known as Huntingtin Interacting Protein 14 (HIP14), belongs to the family of 23 mammalian DHHC-domain containing palmitoyl transferases (PATs) . Its distinctive structural features include:

  • A catalytic DHHC domain essential for its palmitoyl transferase activity

  • Ankyrin repeat domains, which are protein interaction motifs involved in substrate recognition

  • ZDHHC17 and its paralog ZDHHC13 (HIP14L) are the only mammalian PATs that possess ankyrin repeat domains

  • Primarily expressed in the brain, where it localizes to the Golgi apparatus and cytoplasmic vesicles in neurons

The ankyrin repeat domain (ANK17) in ZDHHC17 plays a crucial role in substrate recognition by interacting with ANK binding motifs (zDABM) in substrate proteins, with tryptophan 130 (W130) being critical for these interactions in some cases .

What is the primary catalytic function of ZDHHC17?

The primary catalytic function of ZDHHC17 is to mediate protein S-palmitoylation, which involves the addition of palmitic acid (a 16-carbon fatty acid) to cysteine residues of target proteins via a thioester bond . As a palmitoyl acyltransferase (PAT), ZDHHC17:

  • Regulates the palmitoylation and trafficking of several synaptic proteins, including huntingtin (HTT), SNAP-25, GAD-65, PSD-95, and synaptotagmin I

  • Undergoes auto-palmitoylation as part of its catalytic cycle, which correlates with its PAT activity

  • Demonstrates substrate selectivity, palmitoylating specific proteins such as Smad7 while not modifying related proteins like Smad2, Smad3, Smad4, and Smad6

  • Targets specific cysteine residues within its substrates, as shown by the identification of four cysteine residues in Smad7 (Cys202, Cys225, Cys415, and Cys417) that are palmitoylated by ZDHHC17

This enzymatic activity is essential for proper protein localization, trafficking, and function, particularly in neuronal contexts.

How does ZDHHC17 differ from other palmitoyl acyltransferases?

ZDHHC17 possesses several distinctive features that differentiate it from other palmitoyl acyltransferases:

  • Substrate selectivity: ZDHHC17 is categorized as a high-selectivity/low-activity enzyme that requires specific recognition of its substrate proteins for successful S-acylation, in contrast to low-selectivity/high-activity isoforms like ZDHHC3 and ZDHHC7

  • Structural uniqueness: It contains ankyrin repeat domains for substrate recognition, a feature shared only with its paralog ZDHHC13 among all 23 mammalian PATs

  • Huntingtin interaction: ZDHHC17 was first identified as a huntingtin-interacting protein with significantly reduced interaction with mutant HTT

  • Dual role of huntingtin: Wild-type HTT not only serves as a palmitoylation substrate for ZDHHC17 but also influences the PAT function of ZDHHC17, potentiating the palmitoylation of other substrates

  • Neural enrichment: ZDHHC17 shows enriched expression in the brain and has specialized functions in neuronal contexts, particularly in synaptic protein regulation

This combination of features makes ZDHHC17 particularly important for neuronal function and potentially relevant to neurological disorders.

What mouse models are available for studying ZDHHC17 function?

Several mouse models have been developed to study ZDHHC17 function, each providing unique insights:

  • Hip14-/- (complete knockout) mice: Display behavioral, biochemical, and neuropathological defects reminiscent of Huntington's disease, including striatal volume loss and MSN (medium spiny neuron) loss

  • Hip14+/- (heterozygous) mice: Show normal brain development, indicating that approximately 50% of functional HIP14 is adequate for normal development

  • YAC128 mice: Contain the entire human HTT gene with 128 CAG repeats and have been used to study the relationship between mutant huntingtin and ZDHHC17 function

The Hip14-/- mice display several HD-like phenotypes, including:

  • Early striatal volume loss (detectable by embryonic day 17.5)

  • Reduced palmitoylation of ZDHHC17 substrates like PSD-95 and SNAP-25

  • Motor coordination deficits resembling those seen in HD models

Interestingly, unlike YAC128 mice, the striatal volume loss in Hip14-/- mice does not progressively worsen, suggesting different mechanisms of neurodegeneration .

What techniques are commonly used to detect ZDHHC17-mediated protein palmitoylation?

Several specialized techniques are used to detect and analyze ZDHHC17-mediated protein palmitoylation:

  • Acyl-RAC (Resin-Assisted Capture) assay: This method involves treating samples with hydroxylamine to cleave thioester bonds, followed by capture of newly exposed thiols with thiol-reactive resin

  • Metabolic labeling with alkynyl palmitic acid: Cells are treated with alkynyl palmitic acid analogs, followed by a click chemistry reaction to attach detection tags to palmitoylated proteins

  • Co-immunoprecipitation assays: Used to detect physical interactions between ZDHHC17 and potential substrate proteins

  • Auto-palmitoylation assessment: Since ZDHHC17 undergoes auto-palmitoylation as part of its catalytic cycle, measuring its own palmitoylation can be used as a marker of its PAT activity

  • Site-directed mutagenesis: To identify specific cysteine residues that are palmitoylated, individual cysteines are mutated and the impact on palmitoylation is assessed

When studying ZDHHC17 activity in YAC128 mouse brains, researchers found that both Hip14 auto-palmitoylation and its ability to palmitoylate substrates like Snap-25 were significantly decreased, demonstrating ZDHHC17 dysfunction in the presence of mutant HTT .

How can researchers identify specific palmitoylation sites in ZDHHC17 substrates?

Identifying specific palmitoylation sites in ZDHHC17 substrates requires a methodical approach:

  • Truncation mutant analysis: Creating deletion mutants to determine which regions of the substrate protein contain palmitoylation sites

  • Site-directed mutagenesis: Systematically mutating individual cysteine residues to serine and assessing the impact on palmitoylation

  • Combined mutations: Creating mutants with multiple cysteine-to-serine substitutions to identify all potential palmitoylation sites

  • Click chemistry with mass spectrometry: Using alkynyl palmitate labeling followed by click chemistry and mass spectrometry to directly identify modified residues

This approach was successfully used to identify four cysteine residues in Smad7 (Cys202, Cys225, Cys415, and Cys417) as targets for ZDHHC17-mediated palmitoylation . The research revealed that both the linker region cysteines (C202 and C225) and the C-terminal MH2 cysteines (C415 and C417) are palmitoylated by ZDHHC17, with palmitoylation occurring preferentially in the C-terminal part of Smad7 .

How does huntingtin (HTT) mutation affect ZDHHC17 function in Huntington's disease?

Huntingtin (HTT) mutation has profound effects on ZDHHC17 function, potentially contributing to Huntington's disease pathogenesis:

  • Wild-type HTT potentiates the palmitoylation of ZDHHC17 substrates, but this property is lost with mutant HTT containing expanded polyglutamine tracts

  • In YAC128 mouse brains, ZDHHC17 protein levels remain unchanged, but its palmitoylation activity is significantly decreased

  • Both ZDHHC17 auto-palmitoylation (a marker of PAT activity) and its ability to palmitoylate substrates like SNAP-25 are reduced in the presence of mutant HTT

  • ZDHHC17 isolated from YAC128 brains shows significantly reduced PAT activity when assayed for its ability to palmitoylate Snap-25

These findings suggest a model where:

  • Mutant HTT does not affect ZDHHC17 expression levels but renders it dysfunctional

  • Reduced ZDHHC17 activity leads to decreased palmitoylation of neuronal substrates

  • Impaired substrate palmitoylation contributes to synaptic dysfunction and neurodegeneration in HD

The similarities between Hip14-/- mice and YAC128 mice, coupled with the altered function of ZDHHC17 in HD, highlight the potential importance of palmitoylation in HD pathogenesis .

What is the relationship between ZDHHC17 and its paralog ZDHHC13 (HIP14L) regarding compensatory mechanisms?

ZDHHC17 and its closest paralog ZDHHC13 (HIP14L) demonstrate a complex relationship characterized by both overlapping and distinct functions:

This partial functional redundancy enables compensatory mechanisms:

The degree of compensation may be relevant in disease contexts:

  • Hip14+/- mice (with 50% ZDHHC17 function) show normal development, suggesting adequate compensation

  • In contrast, the more severe phenotypes in YAC128 HD mice may result from dysfunction of both ZDHHC17 and ZDHHC13 in the presence of mutant HTT, limiting compensatory capacity

Understanding these compensatory mechanisms is crucial for developing therapeutic strategies targeting palmitoylation in neurological disorders.

How does ZDHHC17-mediated palmitoylation of Smad7 impact TGF-β signaling?

ZDHHC17-mediated palmitoylation of Smad7 represents a significant regulatory mechanism for TGF-β signaling:

  • Smad7 is a negative regulator of TGF-β signaling, and its palmitoylation by ZDHHC17 enhances its inhibitory function

  • ZDHHC17 selectively palmitoylates Smad7 at four specific cysteine residues (Cys202, Cys225, Cys415, and Cys417)

  • This palmitoylation is specific to Smad7, as other Smad proteins (Smad2, Smad3, Smad4, and Smad6) are not palmitoylated by ZDHHC17

  • The interaction between Smad7 and ZDHHC17 primarily involves the C-terminal part of Smad7, with binding slightly increased upon TGF-β stimulation

The biological significance of this palmitoylation includes:

  • Enhanced inhibition of TGF-β signaling through Smad7's increased inhibitory function

  • Potential implications for various cellular processes regulated by TGF-β, including proliferation, differentiation, and apoptosis

  • Possible connections to pathological conditions involving dysregulated TGF-β signaling

This finding extends our understanding of ZDHHC17's functions beyond neurological contexts and suggests that alterations in ZDHHC17 activity, such as those occurring in Huntington's disease, might have consequences through dysregulation of TGF-β signaling pathways .

What are critical controls needed when studying ZDHHC17-mediated palmitoylation?

When studying ZDHHC17-mediated palmitoylation, several critical controls are essential:

  • Catalytically inactive ZDHHC17 mutants:

    • Use C467A or C467S mutants that lack PAT activity but maintain protein interactions

    • These serve as negative controls for enzymatic activity while controlling for potential scaffolding functions

  • Palmitoylation inhibitor treatment:

    • Include samples treated with broad-spectrum palmitoylation inhibitors like 2-bromopalmitate (2-BP)

    • This confirms that observed modifications are indeed palmitoylation events

  • Cysteine-to-serine substrate mutants:

    • Mutate potential palmitoylation sites in substrate proteins

    • This helps identify specific sites of ZDHHC17-mediated palmitoylation

  • Hydroxylamine treatment controls:

    • For thioester-specific detection methods, include controls with and without hydroxylamine treatment

    • Hydroxylamine cleaves thioester bonds, confirming that observed modifications are thioester-linked

  • Substrate specificity controls:

    • Test related proteins (e.g., testing Smad2, Smad3, Smad4, and Smad6 alongside Smad7)

    • This demonstrates the specificity of ZDHHC17 for particular substrates

In studies of Smad7 palmitoylation by ZDHHC17, researchers effectively used these controls, showing that a catalytically inactive ZDHHC17 mutant (zDHHC17C467S) was unable to palmitoylate Smad7 to the same level as wild-type ZDHHC17, and that 2-BP treatment inhibited S-acylation of Smad7 .

How can researchers distinguish between direct and indirect effects of ZDHHC17 on protein palmitoylation?

Distinguishing between direct and indirect effects of ZDHHC17 on protein palmitoylation requires a multi-faceted approach:

  • In vitro palmitoylation assays:

    • Perform palmitoylation assays with purified recombinant ZDHHC17 and substrate proteins

    • Direct enzymatic activity in a defined system provides strong evidence for direct palmitoylation

  • Direct binding studies:

    • Demonstrate physical interaction between ZDHHC17 and potential substrates using co-immunoprecipitation

    • The strength of this interaction can provide insights into whether a protein is a direct substrate

  • Site-specific mutagenesis:

    • Identify and mutate specific cysteine residues in the substrate that are palmitoylated by ZDHHC17

    • This approach was successfully used to identify four cysteine residues in Smad7 palmitoylated by ZDHHC17

  • Catalytically inactive ZDHHC17:

    • Use catalytically inactive ZDHHC17 mutants (e.g., C467A/S) while maintaining normal protein-protein interactions

    • This helps separate enzymatic from scaffolding functions

  • Substrate specificity analysis:

    • Test multiple related proteins (as was done with Smad family proteins)

    • Specific palmitoylation of only certain proteins in a family suggests direct enzymatic action

In research on Smad7 palmitoylation, these approaches collectively demonstrated that ZDHHC17 directly palmitoylates Smad7 at specific cysteine residues, while not modifying related Smad proteins .

What factors should be considered when analyzing contradictory findings in ZDHHC17 research?

When analyzing contradictory findings in ZDHHC17 research, several factors should be considered:

  • Experimental system differences:

    • Cell types used (neuronal vs. non-neuronal)

    • Expression systems (endogenous vs. overexpression)

    • Detection methods employed (metabolic labeling vs. Acyl-RAC)

  • Compensatory mechanisms:

    • Presence and activity levels of other PATs, particularly ZDHHC13

    • In Hip14-/- mice, HTT palmitoylation remains normal despite ZDHHC17 absence, suggesting compensation by other PATs

    • This compensation may vary between experimental systems

  • Substrate-specific effects:

    • ZDHHC17 has different effects on various substrates

    • While some substrates like HTT can be palmitoylated by multiple PATs, others like PSD-95 show more specific dependence on ZDHHC17

  • Developmental and contextual factors:

    • The early embryonic striatal volume loss observed in Hip14-/- mice does not progressively worsen, suggesting developmental compensation

    • ZDHHC17 function may be differentially regulated in various cellular contexts or disease states

  • Experimental timing:

    • Temporal dynamics of ZDHHC17 activity and substrate palmitoylation may lead to different observations at different time points

Understanding these factors can help reconcile seemingly contradictory findings and develop a more nuanced understanding of ZDHHC17 biology and its implications for neurological disorders .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.