Recombinant Mouse Palmitoyltransferase ZDHHC18 (Zdhhc18)

Shipped with Ice Packs
In Stock

Description

Functional Role in Research

ZDHHC18 is implicated in regulating innate immunity by palmitoylating cyclic GMP-AMP synthase (cGAS), a DNA sensor. Key findings from studies using recombinant ZDHHC18 include:

  • Mechanistic Insight:

    • ZDHHC18-mediated palmitoylation at cGAS residue C474 inhibits cGAS/DNA complex formation, suppressing cGAS dimerization and downstream immune signaling .

    • Overexpression of ZDHHC18 reduces cGAMP production and IRF3 phosphorylation, confirming its role as a negative regulator of the cGAS-STING pathway .

  • Experimental Applications:

    • Luciferase Assays: Used to measure ZDHHC18’s dose-dependent suppression of IFN-β promoter activity .

    • Mass Spectrometry: Quantified cGAMP levels post-ZDHHC18 modulation .

    • Phosphorylation Studies: Assessed TBK1 and STING activation in ZDHHC18-deficient cells .

Related Products and Variants

Recombinant ZDHHC18 is available in multiple formats for diverse experimental needs:

Product IDSpeciesTagApplication
RFL21794MFMouseHisEnzyme kinetics, structural studies
ZDHHC18-10314MMouseHis-Fc-AviProtein interaction assays
RFL6037RFRatHisCross-species comparative studies

Research Implications

  • Therapeutic Targets: ZDHHC18’s regulatory role in cGAS activation highlights its potential as a drug target for autoimmune diseases and viral infections .

  • Tool Development: Recombinant ZDHHC18 enables high-throughput screening of palmitoylation inhibitors or activators, as seen in cadmium chloride studies .

Technical Considerations

  • Stability: Repeated freeze-thaw cycles degrade the protein; aliquot storage is recommended .

  • Activity Validation: Functional assays (e.g., acyl-RAC) are required to confirm palmitoyltransferase activity post-reconstitution .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
Zdhhc18; Palmitoyltransferase ZDHHC18; DHHC domain-containing cysteine-rich protein 18; DHHC-18; Zinc finger DHHC domain-containing protein 18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-380
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Zdhhc18
Target Protein Sequence
MKDCEYQQISPGAAPPPASPGARRPGPAAPPAPSPGPAPGAPRWSGSGSGSGSLGRRPRR KWEVFPGRNRFYCGGRLMLAGHGGVFALTLLLILSTTILFFVFDCPYLARTLTLAIPIIA AILFFFVMSCLLQTSFTDPGILPRATICEAAALEKQIDNTGSSTYRPPPRTREVMINGQT VKLKYCFTCKMFRPPRTSHCSVCDNCVERFDHHCPWVGNCVGRRNYRFFYAFILSLSFLT AFIFACVVTHLTLLSQGSNFLSALKKTPASVLELVICFFSIWSILGLSGFHTYLVASNLT TNEDIKGSWSSKRGGEASVNPYSHKSIITNCCAVLCGPLPPSLIDRRGFVQSDTALPSPI RSDDPACGAKPDASMVGGHP
Uniprot No.

Target Background

Function
Palmitoyltransferase that catalyzes the addition of palmitate to various protein substrates. Palmitoylates HRAS and LCK. May also exhibit palmitoyltransferase activity toward the beta-2 adrenergic receptor (ADRB2) and therefore regulate G protein-coupled receptor signaling.
Database Links
Protein Families
DHHC palmitoyltransferase family, ERF2/ZDHHC9 subfamily
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitously expressed.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.