Recombinant Mouse Palmitoyltransferase ZDHHC7 (Zdhhc7)

Shipped with Ice Packs
In Stock

Description

Functional Roles

ZDHHC7 catalyzes S-palmitoylation, transferring palmitate groups to cysteine residues on target proteins. Key findings include:

Mechanistic Insights

  • Substrate Specificity: Directly palmitoylates NLRP3 at Cys126, promoting inflammasome assembly and ASC oligomerization .

  • Subcellular Localization: Mediates NLRP3 trafficking to the trans-Golgi network (TGN) in resting macrophages and dispersed TGN during activation .

Target ProteinFunctionBiological Impact
NLRP3Inflammasome activationAccelerates endotoxic shock and peritonitis
IFITM3Viral restrictionEnhances antiviral activity
STX7Vesicle traffickingRegulates membrane fusion

Inflammasome Studies

  • Knockout Models: Zdhhc7-null macrophages show reduced NLRP3 activation and IL-1β secretion .

  • Therapeutic Potential: Targeting ZDHHC7 suppresses NLRP3-driven inflammation in murine peritonitis models .

Chemical-Proteomic Profiling

  • Substrate Mapping: Engineered ZDHHC7 mutants paired with "bumped" lipid probes enable proteome-wide identification of S-acylated proteins .

Technical Considerations

  • Storage: Lyophilized powder stable at -80°C; reconstitute in Tris/PBS buffer with 6% trehalose .

  • Activity Assays: Validated via fluorescence resonance energy transfer (FRET) and co-immunoprecipitation (co-IP) .

Comparative Analysis with Human Orthologs

FeatureMouse ZDHHC7Human ZDHHC7
Catalytic EfficiencyHigher autoacylation in E. coli Broader substrate range in HEK293 cells
Pathway InvolvementNLRP3 inflammasome regulation Cancer metastasis, neuronal signaling

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
Zdhhc7; Gramp2; Palmitoyltransferase ZDHHC7; Acyltransferase ZDHHC7; GABA-A receptor-associated membrane protein 2; SERZ-beta; Zinc finger DHHC domain-containing protein 7; DHHC-7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Zdhhc7
Target Protein Sequence
MQPSGHRLRDIEHHPLLTDNDNYDSASSSSSETDMADRVWFIRDGCGMVCAVMTWLLVVY ADFVVTFVMLLPSKDFWYSVVNGVLFNCLAVLALSSHLRTMLTDPGAVPKGNATKEYMES LQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTM YIALSSVHALILCGLQFISCVRGQWTECSDFSPPITVILLVFLCLEGLLFFTFTAVMFGT QIHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRLRRLQMRTR KGGPEFSV
Uniprot No.

Target Background

Function
ZDHHC7, a Golgi-localized palmitoyltransferase, catalyzes the addition of palmitate onto various protein substrates, playing a crucial role in diverse biological processes. It exhibits broad fatty acid selectivity and can transfer myristate from tetradecanoyl-CoA and stearate from octadecanoyl-CoA onto target proteins in addition to palmitate. ZDHHC7 palmitoylates sex steroid hormone receptors, including ESR1, PGR, and AR, regulating their localization to the plasma membrane and their involvement in rapid intracellular signaling upon sex hormone binding. It palmitoylates GNAQ, a heterotrimeric G protein, modulating its dynamic localization at the plasma membrane and contributing to GNAQ-dependent G protein-coupled receptor signaling pathways. ZDHHC7 also functions in ligand-induced cell death by regulating the FAS signaling pathway through palmitoylation and stabilization of the receptor at the plasma membrane. In epithelial cells, ZDHHC7 palmitoylates SCRIB, regulating its localization to the plasma membrane and indirectly influencing cell polarity and differentiation. Additionally, ZDHHC7 palmitoylates JAM3, promoting its expression at tight junctions and regulating its role in cell migration. ZDHHC7 also palmitoylates the glucose transporter GLUT4/SLC2A4, controlling the insulin-dependent translocation of GLUT4 to the plasma membrane. In the brain, ZDHHC7 could potentially palmitoylate SNAP25 and DLG4/PSD95. It could also palmitoylate DNAJC5, regulating its localization to the Golgi membrane, and may palmitoylate NCDN. ZDHHC7 may play a role in follicle stimulation hormone (FSH) activation of testicular Sertoli cells.
Gene References Into Functions
  1. DHHC7 knockout mice developed hyperglycemia and glucose intolerance, confirming that DHHC7 is the primary PAT for Glut4 and that this mechanism is essential for insulin-regulated glucose homeostasis. PMID: 28057756
Database Links
Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitously expressed, with highest levels in liver, kidney and brain. Expressed in all brain regions.

Q&A

Basic Research Questions

  • What is ZDHHC7 and what is its primary function in cellular systems?

    ZDHHC7 is a member of the DHHC domain-containing protein family that functions as a palmitoyltransferase enzyme. Its primary role is catalyzing the addition of palmitate, a 16-carbon fatty acid, to specific cysteine residues in target proteins through a thioester bond (S-palmitoylation). This post-translational modification is critical for regulating protein localization, stability, and function.

    ZDHHC7 is expressed in various tissues and cell types, with notable expression patterns in prostate epithelial cells. Studies have demonstrated that ZDHHC7 expression is frequently decreased in cancer cell lines compared to normal epithelial cells, suggesting potential tumor suppressor functions .

  • What are the validated substrates of mouse ZDHHC7?

    ZDHHC7 has several confirmed substrates involved in cellular polarity and signaling:

    SubstrateFunctionPalmitoylation SitesEffect of Palmitoylation
    Scribble (SCRIB)Cell polarity regulatorCysteine 4 and 10Membrane localization and maintenance of cell polarity
    MTDHMetastasis regulatorUnder investigationPotentially affects metastatic potential

    Researchers have established that ZDHHC7-mediated palmitoylation of Scribble is particularly critical for maintaining proper cellular polarity. When ZDHHC7 expression is lost or reduced, Scribble palmitoylation decreases, leading to its mislocalization from cell membranes .

  • What methods are used to detect and measure ZDHHC7-mediated protein palmitoylation?

    Several complementary approaches can be employed to detect ZDHHC7-mediated palmitoylation:

    • Acyl-Biotin Exchange (ABE) Assay: This method allows for the detection of palmitoylated proteins by replacing palmitate groups with biotin, followed by pull-down with streptavidin and western blotting.

    • Metabolic Labeling: Cells are treated with alkyne or azide-modified palmitate analogs that can be conjugated to reporter molecules via click chemistry.

    • Palmitoylation-specific Antibodies: For detection of specific palmitoylated proteins when available.

    • Confocal Microscopy: To visualize the localization of potential substrates like Scribble, which demonstrates membrane localization when properly palmitoylated .

    Researchers commonly validate palmitoylation by expressing wild-type proteins alongside palmitoylation-deficient mutants (e.g., SCRIB C4/10S mutant) in cell lines to compare cellular localization and function .

  • How can researchers generate functional recombinant mouse ZDHHC7 for in vitro studies?

    Producing functional recombinant ZDHHC7 requires careful attention to its transmembrane domain structure:

    1. Expression System Selection: Mammalian expression systems (HEK293 cells) are preferred over bacterial systems to ensure proper folding and post-translational modifications.

    2. Vector Design: Incorporate appropriate tags (His, FLAG, or GST) at the N-terminus to avoid disrupting the catalytic DHHC domain.

    3. Solubilization Strategy: Use mild detergents (DDM or CHAPS) during membrane protein extraction to maintain enzymatic activity.

    4. Activity Verification: Confirm enzyme activity through in vitro palmitoylation assays using known substrates like Scribble.

    5. Storage Considerations: Store with glycerol at -80°C with protease inhibitors to maintain stability and enzymatic activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.