Recombinant Mouse Palmitoyltransferase ZDHHC9 (Zdhhc9)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Substrates

ZDHHC9 modulates diverse cellular processes through S-acylation of specific substrates:

SubstrateFunctional ImpactCitation
HRAS/NRASEnhances membrane localization and oncogenic signaling .
Rab3gap1Regulates Rab3a-GTP levels and atrial natriuretic peptide (ANP) secretion .
β-cateninPromotes ubiquitination and degradation, suppressing renal fibrosis .
CGASFacilitates homodimerization and innate immune activation .
GSDMDActivates pyroptosis by promoting membrane pore formation .

Neurological and Myelinogenesis Defects

  • Zdhhc9 Knockout (KO) Mice:

    • Myelination: Reduced density of myelinated axons in the corpus callosum, hypomyelination (increased g-ratio), and disrupted myelin compaction .

    • Behavioral Phenotypes: Reduced anxiety, spatial learning deficits, and hypotonia linked to corpus callosum atrophy .

    • Oligodendrocyte Dysregulation: Shift from myelination-associated MOL2/3 cells to adhesion-focused MOL5/6 subtypes .

Renal Fibrosis and β-catenin Regulation

  • DHHC9 Overexpression: Attenuates kidney fibrosis by promoting β-catenin palmitoylation, ubiquitination, and degradation .

  • APT1 Interaction: Depalmitoylation by APT1 increases β-catenin stability, exacerbating fibrotic pathways .

Immune Modulation

  • CGAS Palmitoylation: Enhances cyclic GMP-AMP synthase activity, boosting antiviral responses .

  • PD-L1 Stabilization: Promotes tumor immune evasion; inhibition sensitizes cancer cells to T-cell killing .

Applications in Experimental Research

Recombinant Zdhhc9 is utilized to:

  1. Study Ras-driven cancers via HRAS/NRAS membrane dynamics .

  2. Model kidney fibrosis and test antifibrotic therapies .

  3. Investigate neurodevelopmental disorders linked to S-acylation defects .

  4. Develop immunotherapies targeting PD-L1/PD-1 palmitoylation .

Production and Validation

  • Expression Systems: Typically produced in E. coli or wheat germ, with full-length (1–364 aa) constructs .

  • Antibody Validation: Commercial antibodies (e.g., Proteintech 24046-1-AP, Abcam ab74504) confirm specificity via WB, IHC, and IF across tissues .

Table 2: Key Research Tools for Zdhhc9 Studies

ToolApplicationReactivitySource
Anti-ZDHHC9 (ab74504)WB, IHC-PHuman, Mouse
Recombinant Zdhhc9Enzyme assaysIn vitro
Zdhhc9 KO MiceNeurological studiesIn vivo

Therapeutic Implications

  • Heart Failure: Enhancing ANP secretion via Rab3gap1 modulation .

  • Cancer: Targeting PD-L1 palmitoylation to improve checkpoint blockade efficacy .

  • Kidney Disease: Restoring DHHC9 activity to suppress β-catenin-driven fibrosis .

Unresolved Questions

  • Substrate Redundancy: Overlap with other zDHHC enzymes in Ras palmitoylation .

  • Neurological Mechanisms: How Zdhhc9 loss specifically disrupts oligodendrocyte maturation .

  • Tissue-Specific Roles: Contrasting effects in renal tubular cells vs. cardiomyocytes .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Zdhhc9; Palmitoyltransferase ZDHHC9; Zinc finger DHHC domain-containing protein 9; DHHC-9; DHHC9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-364
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Zdhhc9
Target Protein Sequence
MSVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLILGTCTLFFAFECRYL AVQLSPAIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAFIEMEIEATNGAVPQGQ RPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRN YRYFYLFILSLSLLTIYVFAFNIVYVALKSLKIGFLETLKETPGTVLEVLICFFTLWSVV GLTGFHTFLVALNQTTNEDIKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPPSVLDRRG ILPLEESGSRPPSTQETSSSLLPQSPASTEHMNSNEMAEDTSIPEEMPPPEPPEPPQEAS EAEK
Uniprot No.

Target Background

Function
Palmitoyltransferase catalyzes the addition of palmitate to various protein substrates. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS. It may also exhibit palmitoyltransferase activity towards the beta-2 adrenergic receptor/ADRB2, thereby regulating G protein-coupled receptor signaling.
Database Links
Protein Families
DHHC palmitoyltransferase family, ERF2/ZDHHC9 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the tissue-specific expression pattern of Zdhhc9 in mice?

Zdhhc9 demonstrates variable expression across different tissues. In the kidneys, it is expressed in both proximal and distal tubule cells, with expression levels decreasing during fibrotic conditions such as unilateral ureteral obstruction (UUO) or ischemia-reperfusion injury (IRI) . In the brain, Zdhhc9 is highly expressed in oligodendrocytes, with expression levels exceeding those of other palmitoyltransferases in both mouse and human oligodendrocytes . In cardiac tissue, Zdhhc9 is expressed in cardiomyocytes where it regulates atrial natriuretic peptide (ANP) release .

To determine the expression profile in your tissue of interest, quantitative RT-PCR with tissue-specific RNA extraction is recommended, followed by Western blot confirmation of protein levels. For cellular localization, immunohistochemical staining coupled with confocal microscopy provides spatial resolution of expression patterns.

How does Zdhhc9 subcellular localization differ from other palmitoyltransferases?

Unlike many other palmitoyltransferases that predominantly localize to cell bodies, Zdhhc9 uniquely localizes to puncta in oligodendrocyte processes, which likely represent Golgi outposts . This distinctive subcellular distribution may explain why loss of Zdhhc9 function cannot be compensated by other palmitoyltransferases. Interestingly, XLID-associated mutant forms of Zdhhc9 are restricted to cell bodies, suggesting that proper subcellular localization is crucial for its function .

For examining subcellular localization, fluorescent protein tagging (e.g., GFP-Zdhhc9) combined with markers for different organelles (Golgi, ER, endosomes) is recommended. Super-resolution microscopy techniques like STED or STORM can provide nanoscale resolution of Zdhhc9 localization at Golgi outposts.

What are the most effective methods for generating Zdhhc9 knockout or transgenic mouse models?

Two complementary approaches have been documented in the literature:

  • Cardiomyocyte-specific Zdhhc9 transgenic mice: Generated using the bigenic tet-off α-myosin heavy chain (MHC) promoter expression system. Mouse Zdhhc9 cDNA was cloned into a modified α-MHC promoter expression plasmid using SalI and HindIII restriction sites followed by NotI digestion and gel purification for oocyte injection . This approach allows tissue-specific and temporally controllable expression.

  • Global Zdhhc9 knockout: While specific methodological details aren't fully described in the provided references, functional analysis of Zdhhc9 knockout mice revealed normal oligodendrocyte lineage cell generation but abnormal morphology and myelin ultrastructure .

For targeted disruption of Zdhhc9, CRISPR-Cas9 genome editing is currently the most efficient approach. Target sites should be selected in early exons to ensure complete loss of function. When designing transgenic overexpression models, consider using an inducible system (Tet-On/Off) to control temporal expression.

What viral vectors are optimal for Zdhhc9 overexpression or knockdown studies?

Recombinant adenovirus systems have been successfully employed for Zdhhc9 studies:

  • AdEasy Adenoviral Vector System: Used for subcloning Zdhhc9 into the pShuttle-CMV vector followed by recombination in E. coli cells and transfection in AD-293 cells . This system provides high-titer virus production.

  • RAPAd CMV Adenoviral Expression System: Used with the pacAd5-CMV-K-N-pA shuttle vector and the In-Fusion HD cloning kit for generating recombinant adenoviruses .

For Zdhhc9 knockdown studies, adenovirus-delivered shRNA or siRNA approaches have been effective. When conducting functional studies, include appropriate controls such as the transferase-deficient DHHS mutant of Zdhhc9, which was generated using site-directed mutagenesis with specific primers .

Vector SystemApplicationAdvantagesConsiderations
AdEasy AdenoviralOverexpressionHigh-titer, efficient transductionTransient expression
RAPAd CMVOverexpressionRapid productionTransient expression
LentiviralStable expressionLong-term studiesLower titer than adenoviral
AAVIn vivo studiesLower immunogenicityLimited packaging capacity

How does Zdhhc9 regulate protein palmitoylation and what are its key substrates?

Zdhhc9 catalyzes the addition of palmitate to specific protein substrates through a thioester bond to cysteine residues. Key substrates identified include:

  • β-catenin: Zdhhc9 palmitoylates β-catenin, promoting its ubiquitination and degradation. This palmitoylation is counteracted by acyl protein thioesterase 1 (APT1), which depalmitoylates β-catenin, increasing its abundance and nuclear translocation .

  • Rab3gap1: Zdhhc9 palmitoylates Rab3gap1, which regulates Rab3a activity. This modification is crucial for atrial natriuretic peptide (ANP) release in cardiomyocytes .

  • Myelin Basic Protein (MBP): With the help of its partner protein Golga7, Zdhhc9 robustly palmitoylates MBP. In Zdhhc9 knockout mice, MBP palmitoylation is impaired, along with altered palmitoyl- and total levels of Myelin-associated Glycoprotein (MAG) .

To identify novel substrates, acyl-biotin exchange (ABE) or metabolic labeling with palmitate analogs (e.g., 17-ODYA) followed by click chemistry and mass spectrometry are recommended approaches. For validation, site-directed mutagenesis of putative palmitoylation sites combined with functional assays should be performed.

What is the molecular mechanism underlying the catalytic activity of Zdhhc9, and how does the DHHS mutation affect its function?

Zdhhc9 belongs to the DHHC family of palmitoyltransferases characterized by a conserved Asp-His-His-Cys (DHHC) motif in the catalytic domain. The cysteine in this motif forms a palmitoyl-enzyme intermediate during the catalytic cycle.

The transferase-deficient DHHS mutant (where cysteine is replaced by serine) has been generated to study the importance of catalytic activity . This mutation abolishes the thioester-forming capability, rendering the enzyme catalytically inactive while maintaining protein structure.

For mechanistic studies, in vitro palmitoylation assays using purified Zdhhc9 (wild-type and DHHS mutant) with various substrates and radiolabeled palmitoyl-CoA can determine substrate specificity and kinetic parameters. Structural studies using X-ray crystallography or cryo-EM would provide insights into the catalytic mechanism, though none are reported in the provided references.

How does Zdhhc9 deficiency impact kidney fibrosis and what molecular pathways are involved?

Zdhhc9 plays a protective role against kidney fibrosis through regulation of the Wnt/β-catenin pathway:

  • Zdhhc9 expression is downregulated in fibrotic kidneys from mouse models and chronic kidney disease (CKD) patients .

  • Ablation of Zdhhc9 in tubular cells aggravates kidney fibrosis, while inducing Zdhhc9 overexpression (via adeno-Zdhhc9 transfection or iproniazid treatment) protects against kidney fibrosis in male mouse models .

  • Mechanistically, Zdhhc9 palmitoylates β-catenin, promoting its ubiquitination and degradation. In contrast, APT1 is induced in fibrotic kidneys and depalmitoylates β-catenin, increasing its abundance and nuclear translocation .

  • β-catenin deletion suppresses TGFβ1-induced fibronectin production in proximal tubular cells, and the effect of Zdhhc9 knockdown on fibronectin production is markedly suppressed in β-catenin-deleted cells .

These findings suggest that therapies targeting Zdhhc9 or its regulation of β-catenin palmitoylation may be beneficial for treating kidney fibrosis.

What are the neurological consequences of Zdhhc9 loss-of-function, and how do they relate to X-linked intellectual disability (XLID)?

Loss-of-function variants in Zdhhc9 are associated with X-linked intellectual disability (XLID) with several neurophysiological consequences:

  • Altered Auditory Processing: Individuals with ZDHHC9-associated XLID show larger amplitude and later peak latency in evoked responses to auditory stimulation, with increased magnetic mismatch negativity (mMMN) amplitude .

  • Abnormal Myelination: Mice lacking Zdhhc9 exhibit normal oligodendrocyte development but display extensive morphological and structural myelin abnormalities. Electron microscopy reveals highly abnormal myelin patterns, with many large axons unmyelinated and some small-diameter axons hypermyelinated .

  • Synaptic Dysfunction: Recurrent neural network modeling suggests that reduced inhibition is a plausible mechanism by which loss of Zdhhc9 function alters cortical dynamics during sensory processing .

  • Neuroanatomical Differences: MRI studies have identified reductions in cortical thickness and connectomic deviations in individuals with ZDHHC9-associated ID, which may increase the risk for epilepsy and cognitive impairments .

For investigating XLID mechanisms, a combination of electrophysiological recordings, neuroimaging, and behavioral assessments in Zdhhc9-deficient models is recommended. Patient-derived iPSCs differentiated into neurons can also provide valuable insights into human-specific pathophysiology.

How can single-cell analysis techniques be applied to study cell-specific roles of Zdhhc9 in heterogeneous tissues?

Single-cell approaches offer powerful tools for dissecting Zdhhc9 functions in heterogeneous tissues:

  • Single-cell RNA sequencing (scRNA-seq): Can identify cell populations with high Zdhhc9 expression and reveal cell-specific transcriptional changes in Zdhhc9-deficient models. This approach is particularly valuable for tissues like brain where multiple cell types (neurons, oligodendrocytes, astrocytes) may be differentially affected.

  • Single-cell proteomics: Emerging techniques like SCoPE-MS (Single Cell ProtEomics by Mass Spectrometry) could potentially detect cell-specific changes in palmitoylated proteins.

  • Spatial transcriptomics: Techniques like MERFISH or Visium can map Zdhhc9 expression patterns within tissue architecture, providing spatial context to expression data.

When applying these techniques, computational integration of multiple data types is essential for comprehensive understanding. Cell type-specific Cre-driver lines combined with floxed Zdhhc9 alleles can further validate findings from single-cell analyses.

What approaches can address the challenge of studying dynamic palmitoylation in live tissues to understand Zdhhc9 function in real-time?

Studying dynamic palmitoylation presents significant technical challenges but several approaches show promise:

  • Bioorthogonal labeling: Click chemistry-compatible palmitate analogs (e.g., 17-ODYA) can be used for pulse-chase experiments to monitor palmitoylation dynamics. When combined with tissue clearing techniques, this approach could potentially visualize palmitoylation in intact tissues.

  • FRET/BRET-based sensors: Development of genetically encoded sensors that undergo conformational changes upon palmitoylation could enable real-time monitoring in live tissues.

  • Chemically-induced dimerization of Zdhhc9: Rapamycin-inducible or optogenetic control of Zdhhc9 localization or activity could provide temporal precision for studying acute effects of palmitoylation.

For in vivo applications, intravital microscopy combined with these approaches could potentially visualize palmitoylation dynamics in living animals. Mathematical modeling of palmitoylation/depalmitoylation kinetics can further enhance interpretation of experimental data.

How do researchers reconcile the tissue-specific functions of Zdhhc9 when developing therapeutic strategies for Zdhhc9-related disorders?

The diverse tissue-specific functions of Zdhhc9 create challenges for therapeutic development:

  • Substrate specificity: Zdhhc9 palmitoylates different substrates in different tissues—β-catenin in kidney , Rab3gap1 in heart , and MBP in oligodendrocytes . Therapeutic strategies must account for this substrate diversity.

  • Compensatory mechanisms: While Zdhhc9 function cannot be fully compensated by other palmitoyltransferases, understanding partial compensation in different tissues is important for predicting side effects.

  • Therapeutic targeting approaches:

    • Small molecule modulators of Zdhhc9 activity

    • Substrate-specific interventions (e.g., targeting β-catenin stability in kidney disease)

    • Tissue-specific delivery systems (e.g., AAV serotypes with tropism for specific tissues)

  • Developmental considerations: The timing of Zdhhc9 intervention may be critical, particularly for neurodevelopmental disorders where early intervention may be necessary.

Research strategies should include systematic comparison of Zdhhc9 function across tissues using consistent methodologies, with particular attention to substrate identification and validation. Therapeutic development should proceed with careful consideration of tissue-specific effects and potential compensatory mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.