Recombinant Mouse Pannexin-3 (Panx3)

Shipped with Ice Packs
In Stock

Description

Table 1: Functional Roles of Recombinant Panx3 in Cellular Models

Cell TypeRecombinant ModelKey FindingsMechanismSource
Osteoblasts (C2C12)Panx3 overexpressionPromotes differentiation via ER Ca²⁺ release and ATP-mediated PI3K/Akt signalingER Ca²⁺ channel; Hemichannel ATP release
Chondrocytes (ATDC5)Panx3 transfectionInhibits PTH-induced proliferation; enhances differentiation via cAMP reductionATP release → P2R/PI3K/Akt inhibition
Odontoblasts (mDP)Panx3 stable transfectionReduces cell proliferation via AMPK/p21; enhances BMP2-induced differentiationHemichannel ATP release → AMPK activation
C2C12 osteoprogenitorsSer68Ala mutant Panx3Inhibits osteoblast differentiation by blocking ER Ca²⁺ channel activityPhosphorylation-dependent gating

Calcium Signaling

  • Panx3 acts as an ER Ca²⁺ channel, activated by PI3K/Akt signaling, which triggers calmodulin pathways for osteoblast differentiation .

  • Phosphorylation at Ser68 is critical for ER Ca²⁺ channel function; mutation to alanine (Ser68Ala) disrupts osteogenic activity .

ATP/cAMP Regulation

  • Panx3 hemichannels release ATP, which:

    • Activates purinergic receptors (P2Rs) to modulate PI3K/Akt and Wnt/β-catenin pathways .

    • Reduces intracellular cAMP, inhibiting PTH-mediated proliferation in chondrocytes .

Differentiation Pathways

  • Osteoblasts: Panx3 promotes differentiation via Ca²⁺/calmodulin and BMP/Smad signaling .

  • Odontoblasts: Panx3 enhances BMP2-induced Dspp expression and cell cycle exit via AMPK/p21 .

Table 2: Regulatory Phosphorylation Sites

ResidueModificationFunctional ImpactModel SystemSource
Ser68PhosphorylationEnables ER Ca²⁺ channel activity; essential for osteoblast differentiationC2C12 cells

Pathophysiological Relevance

  • Bone Development: Panx3 knockout mice exhibit dwarfism and reduced bone density due to impaired ossification .

  • Cartilage Disorders: Panx3 modulates ATP/cAMP balance, counteracting PTHrP signaling in chondrocytes .

  • Dentinogenesis: Panx3 coordinates BMP2-mediated odontoblast differentiation via Smad1/5/8 phosphorylation .

Technical Applications

Recombinant Panx3 is utilized in:

  • Loss-of-function studies: siRNA or inhibitory peptides block endogenous Panx3 to validate its roles .

  • Live-cell imaging: Tracking Ca²⁺ waves propagated through Panx3 gap junctions .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please specify them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to gather the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
Panx3; Pannexin-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-392
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Panx3
Target Protein Sequence
MSLAHTAAEYMLSDALLPDRRGSRLKGLRLELPLDKMVKFITVGFPLLLMSLAFAQEFSS GSPISCFSPSNFSVRQAAYVDSSCWDSLAHHTQDKAGQYKVKSLWPHKALPYSLLALAVA MYLPVLLWQYVAVPSLSSDLLFIISELDKSYNRSIRLVQHMLQIRQSSSDPHVFWDELEK ARKERYFEFPLLERYLECKQRSHWLVATYLLRNALLLLFTSATYLYLGQFHLDVFFQDEF NCFIKTGLLHDETHVPELITCRLTSLSVFQIVSVSSAAIYTILVPVIIYNLTRLCRWDKG LLSIYEMLPAFDLLSRKMLGCPINDLNVILLFLRANISELISFSWLSVLSVLKDTTTQKH NIDTVVDFMTFVAGLEPSKPKHLTQHTYDEHA
Uniprot No.

Target Background

Function
Pannexin-3 (Panx3) is a structural component of gap junctions and hemichannels.
Gene References Into Functions
  1. Panx3 modulates intracellular ATP levels, inhibiting odontoblast proliferation via the AMPK/p21 signaling pathway and promoting cell differentiation through the BMP/Smad signaling pathway. PMID: 28494020
  2. Data suggest that Panx1 and Panx3 are not essential for baseline hearing in mice. However, targeting Panx3 therapeutically may protect against mid-high-frequency hearing loss caused by loud noise exposure. PMID: 27784763
  3. Research has identified genetic loci influencing both body mass index and carcinogenesis, implicating Panx3 as a potential link between these phenotypes through its effects on inflammation and lipid metabolism. PMID: 27506198
  4. Panx3 ablation exhibits phenotypic effects in mouse femora and humeri, supporting its role in regulating long bone growth and development. PMID: 26749194
  5. Panx3 functions as an endoplasmic reticulum (ER) Ca(2+) channel to promote differentiation and can rescue mineralization defects in Cx43(-/-) calvarial cells. PMID: 26759176
  6. Mice lacking Panx3 are resistant to osteoarthritis development. PMID: 26138248
  7. Results provide evidence of Panx3's crucial roles in vertebrate skeletal development in vivo. PMID: 26183770
  8. Panx3 acts as a regulator promoting the switch from osteoprogenitor proliferation to differentiation via multiple signaling pathways. PMID: 24338011
  9. Panx3 plays a significant role in bone development and is a novel target for Runx2-dependent signaling. PMID: 21915903
  10. Panx3 promotes osteoblast differentiation by functioning as an ER Ca(2+) channel, a hemichannel, and by forming gap junctions. PMID: 21690309
  11. Panx3 regulates the switch from chondrocyte proliferation to differentiation by controlling intracellular ATP/cAMP levels. PMID: 20404334
  12. Panx1 and Panx3 are coexpressed in the mammalian epidermis, and regulating Panx1 plays a key role in keratinocyte differentiation. PMID: 20332104
  13. While Panx1 and Panx3 share a common endoplasmic reticulum to Golgi secretory pathway to Cx43, their ultimate cell surface residency is independent of cell contacts and the need for intact microtubules. PMID: 20086016
  14. Panx1 can interact with Panx3 in a glycosylation-dependent manner. Panx3 can traffic to the cell surface and form functional single-membrane channels. PMID: 19692571
  15. Research indicates that Panx1 and Panx3 exhibit distinct characteristics from Cx43 and likely play significant biological roles as single membrane channels. PMID: 17925379
  16. The diverse expression and distribution profiles of Panx1 and Panx3 suggest that they may have multiple cellular functions. PMID: 18649185
  17. Results demonstrate abundant expression of pannexins 1, 2, and 3 in the mouse and rat cochlea with distinct cellular distributions. PMID: 19009624

Show More

Hide All

Database Links
Protein Families
Pannexin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Tissue Specificity
Expressed in skin, cartilage, heart, lung, liver, spleen, thymus and kidney. Not expressed in brain.

Q&A

What is the molecular structure and primary function of Pannexin-3?

Pannexin-3 is a member of the gap junction protein family that forms three distinct functional channels: hemichannels, gap junctions, and endoplasmic reticulum (ER) Ca²⁺ channels. Structurally, Panx3 contains several phosphorylation sites, with serine 68 (Ser68) being particularly important for its function as an ER Ca²⁺ channel. The protein plays a critical role in regulating bone formation through modulation of cellular differentiation pathways, particularly in osteoblasts and chondrocytes .

What is the expression pattern of Panx3 during skeletal development?

Panx3 demonstrates a tissue-specific expression pattern during development. Panx3 mRNA is predominantly expressed in the prehypertrophic zone of the developing growth plate and is induced during the differentiation of chondrogenic cells, including ATDC5 and N1511 cell lines. Using phospho-specific antibodies (P-Panx3), researchers have observed Panx3 phosphorylation in prehypertrophic chondrocytes, hypertrophic chondrocytes, and bone areas of newborn growth plates . This spatiotemporal expression pattern suggests Panx3's role in regulating the transition from chondrocyte proliferation to differentiation.

How does Panx3 regulate chondrocyte differentiation?

Panx3 functions as a molecular switch that transitions chondrocytes from proliferation to differentiation by regulating intracellular ATP/cAMP levels. When Panx3 is expressed in ATDC5 cells, it promotes ATP release into the extracellular space through its hemichannel function. This activity reduces intracellular cAMP levels and inhibits the activation of cAMP-response element-binding protein (CREB), a protein kinase A downstream effector . Consequently, Panx3-transfected cells show reduced parathyroid hormone-induced proliferation and enhanced differentiation markers, including Osterix and alkaline phosphatase (ALP) expression .

What signaling pathways interact with Panx3 function?

Panx3 interacts with several key signaling pathways:

Signaling PathwayInteraction with Panx3Functional Outcome
PI3K/Akt pathwayPhosphorylates Ser68 on Panx3Activates Panx3 ER Ca²⁺ channel function
ATP signalingStimulates Panx3 phosphorylationChanges channel conformation and activation
PTH/cAMP pathwayInhibited by Panx3 expressionReduced cell proliferation, enhanced differentiation
Bcl6 transcription factorStabilized by Panx3 bindingSuppression of Nox4 expression, reduced oxidative stress

These pathways collectively demonstrate how Panx3 functions at the intersection of multiple signaling networks to regulate cellular differentiation and function .

What mechanisms regulate the gating of Panx3 ER Ca²⁺ channels?

The gating of Panx3 ER Ca²⁺ channels is critically regulated by phosphorylation, with serine 68 (Ser68) being a key regulatory residue. Research has identified 17 candidate phosphorylation sites in Panx3, but mutation studies revealed that the Ser68 to Alanine (Ser68Ala) mutation alone was sufficient to inhibit Panx3-mediated osteoblast differentiation by reducing Osterix and ALP expression .

The phosphorylation mechanism involves:

  • ATP stimulation activates the PI3K/Akt signaling pathway

  • Activated Akt phosphorylates Ser68 on Panx3

  • Phosphorylation induces conformational changes in Panx3 (demonstrated by real-time FRET imaging)

  • The conformational change opens the ER Ca²⁺ channel

  • Ca²⁺ release from ER promotes osteoblast differentiation

Importantly, the Ser68Ala mutation specifically affects the ER Ca²⁺ channel function without impairing Panx3's hemichannel or gap junction functions, indicating the specificity of this regulatory mechanism .

How do researchers explain the contradictory findings in Panx3 knockout studies?

The contradictory findings in Panx3 knockout studies highlight important considerations for experimental design. Two groups used the identical DNA construct from the KOMP2 consortium but employed different Cre-deleter lines:

StudyCre-deleter LinePhenotypic OutcomeKey Observations
Moon et al., 2015CMV-cre miceNo ossification phenotypeIncreased prenatal lethality; surviving mice normal up to 6 weeks
Oh et al., 2015Ella-Cre miceOssification phenotypeShortened limbs at birth; 5-10% decrease in bone size persisting to 8 weeks

These differences suggest that:

  • The genetic background or specific Cre-line may affect phenotypic manifestation

  • The timing or efficiency of gene deletion might differ between the two approaches

  • Compensatory mechanisms might be activated differently depending on when and how Panx3 is deleted

Researchers should carefully consider these variables when designing knockout studies and interpret results with these potential confounding factors in mind.

What methodological approaches are optimal for studying Panx3 channel activity?

For comprehensive investigation of Panx3 channel activity, researchers should employ multiple complementary techniques:

  • Site-directed mutagenesis: Creating specific mutations (e.g., Ser68Ala) to interrogate the function of individual residues in channel regulation

  • Real-time FRET imaging: For monitoring conformational changes in Panx3 channels in response to stimuli like ATP, providing temporal resolution of gating dynamics

  • Calcium imaging: Using calcium-sensitive dyes or genetically encoded calcium indicators to directly measure Ca²⁺ flux through Panx3 ER channels

  • Electrophysiology: Patch-clamp techniques to characterize channel conductance properties

  • Phospho-specific antibodies: Development of antibodies recognizing specific phosphorylated residues (like P-Panx3 for Ser68) to detect activation state in tissues

  • ATP release assays: Quantifying extracellular ATP levels to assess hemichannel function

  • Dye transfer assays: Evaluating gap junction functionality by tracking dye movement between cells

These approaches should be combined with genetic manipulation strategies (overexpression, knockdown, knockout) in relevant cell types to comprehensively characterize Panx3 function .

How can the discrepancies between avian and mouse Panx3 models be reconciled?

The discrepancies between avian and mouse models of Panx3 function represent an important research challenge. In chicken embryos with 3.6-fold PANX3 knockdown, researchers observed only a 20% reduction in forelimb bone volumes with no effects on chondrocyte density, proliferation, hypertrophy markers, or cartilage histology . In contrast, mouse knockout models showed more severe phenotypes, particularly in the Ella-Cre deletion model.

To reconcile these differences, researchers should consider:

  • Evolutionary divergence: Panx3 may have evolved different functions or redundancies across species

  • Knockdown vs. knockout: Partial reduction (knockdown) may allow sufficient residual function compared to complete elimination (knockout)

  • Developmental timing: The stage at which Panx3 function is disrupted may be critical, with earlier disruption potentially having more severe consequences

  • Compensatory mechanisms: Different species may have varying abilities to compensate for Panx3 loss through alternative pathways

  • Experimental design considerations:

    • Use consistent methods to measure comparable outcomes across species

    • Employ inducible or tissue-specific deletions to minimize compensatory adaptations

    • Perform rescue experiments to confirm specificity of observed phenotypes

    • Conduct comparative transcriptomics to identify species-specific response patterns

These approaches can help determine whether the discrepancies reflect true biological differences or methodological variations .

What is the emerging role of Panx3 in endothelial function and metabolic disease?

Recent research has uncovered a novel role for Panx3 as a scaffolding protein that regulates endothelial function and metabolic health. In this context, Panx3 functions in a channel-independent manner by binding to and stabilizing the transcriptional repressor Bcl6. This interaction suppresses the expression of Nox4, which encodes a hydrogen peroxide-producing enzyme .

Key findings include:

  • Mice lacking Panx3 in endothelial cells develop hypertension and show increased oxidative stress

  • A peptide disrupting the Panx3-Bcl6 interaction leads to similar phenotypes, confirming the mechanism

  • Panx3 mRNA expression and Bcl6 protein abundance decrease in diet-induced obesity models but not in pharmacologically induced hypertension

  • Hypertensive, obese individuals show reduced endothelial Panx3 and Bcl6 abundance

These findings suggest that the Panx3-Bcl6 interaction represents a potential therapeutic target for metabolic disease-associated hypertension. Researchers should consider this non-canonical function when designing experiments to study Panx3 in vascular contexts .

What are the optimal methods for validating Panx3 knockdown efficiency?

Validation of Panx3 knockdown requires multiple complementary approaches to ensure both transcriptional and translational suppression:

  • Quantitative PCR (qPCR): Measure Panx3 mRNA levels in target tissues, as demonstrated in studies where forelimb long bones were pooled into biological replicates for RNA extraction and subsequent qPCR

  • Whole-mount in situ hybridization: Visualize spatial expression patterns of endogenous Panx3 following knockdown, allowing assessment of tissue-specific effects

  • Radioactive in situ hybridization: Provide higher sensitivity detection of mRNA expression in tissue sections

  • Western blotting: Quantify Panx3 protein levels to confirm translational suppression

  • Immunohistochemistry: Assess spatial distribution of protein reduction, particularly useful with phospho-specific antibodies

A comprehensive validation approach should include at least three of these methods, with appropriate controls including housekeeping genes and scrambled/non-targeting control constructs.

How should researchers design experiments to resolve conflicting data on Panx3 function?

When confronted with conflicting data on Panx3 function, researchers should implement a systematic experimental design:

  • Standardize experimental systems:

    • Use multiple cell lines and primary cells from the same species

    • Apply consistent culture conditions and passage numbers

    • Employ identical isolation and purification protocols for recombinant proteins

  • Implement genetic rescue experiments:

    • Knockdown endogenous Panx3 and replace with mutant variants

    • Test channel-specific mutations (e.g., Ser68Ala) to dissect function

  • Analyze developmental timing effects:

    • Use inducible expression/deletion systems at different developmental stages

    • Compare acute vs. chronic manipulations of Panx3 function

  • Employ cross-species approaches:

    • Compare Panx3 function across multiple model organisms (mouse, chicken, zebrafish)

    • Analyze sequence conservation and divergence at functional domains

  • Apply comprehensive phenotyping:

    • Utilize standardized phenotyping pipelines

    • Measure multiple outcomes (molecular, cellular, tissue-level, physiological)

This structured approach allows systematic identification of variables contributing to discrepant findings and builds a more complete understanding of context-dependent Panx3 functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.