Recombinant Mouse Paraplegin (Spg7)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Homeostasis

Paraplegin forms the m-AAA protease complex with AFG3L2 in the mitochondrial inner membrane, essential for:

  • Protein Quality Control: Degradation of misfolded proteins and processing of mitochondrial ribosomal subunits .

  • Mitochondrial Dynamics: Regulation of mitochondrial morphology and axonal transport .

  • mPTP Regulation: Modulation of the mitochondrial permeability transition pore, impacting apoptosis and calcium homeostasis .

Mutations in SPG7 cause autosomal recessive spastic paraplegia type 7 (SPG7), characterized by axonal degeneration and mitochondrial dysfunction .

Intramuscular Delivery of AAV-Spg7

Studies in Spg7<sup>−/−</sup> mice demonstrated that recombinant paraplegin delivery via adeno-associated virus (AAV) vectors rescues mitochondrial and neuronal defects:

ParameterFindingsSource
Paraplegin ExpressionAAV2/2-Spg7 restored paraplegin in spinal cord mitochondria, unlike AAV2/1 .
Mitochondrial MorphologyReduced swollen mitochondria in sciatic nerves; improved axonal transport .
Motor PerformanceTreated mice showed sustained rotarod performance improvement (40% increase vs. controls) .

Pharmacological Implications

  • Mitochondrial DNA Stability: SPG7 deficiency correlates with multiple mitochondrial DNA deletions, implicating paraplegin in genome maintenance .

  • Neuronal Viability: Patient-derived neurons with SPG7 mutations exhibit shortened neurites and mitochondrial fragmentation, reversible via paraplegin restoration .

Therapeutic Potential for Neurodegenerative Disorders

Recombinant paraplegin delivery holds promise for SPG7 and related mitochondrial disorders:

  • Gene Therapy: Intramuscular AAV-Spg7 administration targets spinal motor neurons retrograde, mitigating peripheral neuropathy .

  • Reversibility: Even low paraplegin levels rescue mitochondrial morphology, suggesting partial restoration suffices for clinical benefit .

Challenges and Future Directions

  • Targeted Delivery: Enhancing CNS penetration remains critical for addressing corticospinal tract degeneration .

  • Isoform-Specific Effects: The role of ER-localized paraplegin-2 in disease requires further exploration .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Spg7; Paraplegin; Spastic paraplegia 7 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-781
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Spg7
Target Protein Sequence
MAAALLLLRGLRPGPEPRPRRLWGLLSGRGPGLSSGAGARRPYAARGTPVGPAAAGGHAP QSLLLRILTPSFEGISGLLLKQHIVPNAVRLWPLSGSTLYFNTSRMKQKNKDNDKPKGKT PEDDEEEKRRKEREDQMYRERLRTLFIIALVMSLLNSLSTSGGSISWADFVNEMLAKGEV QRVQVVPESDVVEVYLHPGAVVFGRPRLALMYRMQVANIDKFEEKLRAAEDELNIESKDR IPVSYKRTGFFGNALYALGMTAVGLAILWYVFRLAGMTGREGGFSAFNQLKMARFTIVDG KTGKGVSFQDVAGMHEAKLEVREFVDYLKSPERFLQLGAKVPKGALLLGPPGCGKTLLAK AVATEAQVPFLAMAGPEFVEVIGGLGAARVRSLFKEARARAPCIVYIDEIDAVGKKRSTS MSGFSNTEEEQTLNQLLVEMDGMGTTDHVIVLASTNRADVLDNALMRPGRLDRHVFIDLP TLQERREIFEQHLKGLKLTQPSSFYSQRLAELTPGFSGADIANICNEAALHAAREGHTSV HTFNFEYAVERVIAGTAKKSKILSKEEQRVVAFHESGHALVGWLLEHTEAVMKVSIAPRT NAALGFSQMLPRDQYLFTKEQLFERMCMALGGRAAEAISFSRVTSGAQDDLRKVTRIAYS MVKQFGMAPSIGPVSFPEAQEGLMGIGRRPFSQGLQQMMDHEAKLLVAKAYRHTEKVLLD NLDKLQALANALLEKEVINYEDIEALIGPPPHGPKKMIAPQKWIDAEKERQASGEEEAPA P
Uniprot No.

Target Background

Function
Recombinant Mouse Paraplegin (Spg7) is an ATP-dependent zinc metalloprotease involved in the formation and regulation of the mitochondrial permeability transition pore (mPTP). Its proteolytic activity is not essential for this function.
Gene References Into Functions
  1. Studies reveal alternative first exons in both mouse and human SPG7 ESTs. PMID: 22563492
  2. Research demonstrates distinct substrate specificities of m-AAA proteases and highlights an evolutionary shift in proteases involved in the proteolytic processing of dynamin-like GTPases within mitochondria. PMID: 17615298
Database Links
Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the brain and retina (at protein level).

Q&A

What is paraplegin (Spg7) and what cellular functions does it perform?

Paraplegin is a mitochondrial energy-dependent protease encoded by the Spg7 gene. It performs essential functions in mitochondrial quality control and protein homeostasis. Loss of paraplegin causes hereditary spastic paraplegia (HSP), a neurodegenerative disorder characterized by progressive axonal degeneration. In mouse models, paraplegin deficiency leads to accumulation of morphologically abnormal mitochondria in axons, suggesting its crucial role in maintaining mitochondrial integrity and function . This protease likely participates in the degradation of misfolded proteins within mitochondria and may influence mitochondrial morphology regulation, which is particularly important for neuronal function and axonal transport.

How do paraplegin-deficient mouse models (Spg7-/-) manifest their phenotype?

Paraplegin-deficient mice develop a progressive neurodegenerative phenotype that mimics human HSP. The key manifestations include:

  • Late-onset distal axonopathy affecting spinal, optic, and peripheral axons

  • Impaired motor performance beginning at approximately 4 months of age

  • Progressive deterioration in rotarod performance from 4 months onward

  • Axonal swelling due to accumulation of organelles and neurofilaments, indicating impaired axonal transport

  • Mitochondrial morphological abnormalities in synaptic terminals and distal regions of spinal axons

  • Detectable neuropathological changes in peripheral nerves by 10 months of age

Notably, the onset of clinical symptoms precedes detectable spinal cord pathology by approximately 3 months, suggesting that mitochondrial dysfunction occurs well before structural axonal degeneration .

What experimental methods are used to assess motor function in Spg7-/- mice?

The primary method for assessing motor function in paraplegin-deficient mice is the rotarod test, which evaluates motor coordination and balance. In published studies, researchers have used this test to track progressive motor deficits in Spg7-/- mice from adulthood until approximately 15 months of age . The test typically involves:

  • Placing mice on a rotating rod that gradually accelerates

  • Measuring the time each mouse can remain on the rod before falling

  • Performing multiple trials and calculating average performance

  • Conducting monthly testing to track disease progression

It's important to note that after 15 months of age, compliance of mice decreases regardless of genotype, making the test less reliable for older animals. Complementary assessments may include gait analysis, grip strength testing, and evaluation of limb reflexes to provide a more comprehensive functional profile .

What viral vector systems have proven effective for delivering recombinant Spg7 to motor neurons?

Based on experimental evidence, adenoassociated virus (AAV) vectors have demonstrated successful retrograde transport and effective delivery of functional paraplegin to motor neurons. Specifically:

  • AAV2/2 vectors have shown superior efficacy in transducing spinal motor neurons after intramuscular injection compared to AAV2/1

  • Both AAV2/1-Spg7 and AAV2/2-Spg7 successfully express paraplegin in skeletal muscle mitochondria

  • Only AAV2/2-Spg7 consistently demonstrates detectable paraplegin expression in spinal cord mitochondria

  • This retrograde delivery approach enables targeting of affected neurons through a relatively non-invasive peripheral administration route

This retrograde delivery system represents a significant advantage for potential therapeutic applications, as it allows for targeting central nervous system neurons without requiring direct CNS injection.

What are the optimal parameters for intramuscular delivery of AAV-Spg7 vectors?

When designing experiments for intramuscular delivery of AAV-Spg7, researchers should consider the following parameters based on successful studies:

  • Injection sites: Quadriceps and gastrocnemius muscles have been effectively used for targeting sciatic nerve motor neurons

  • Vector serotype: AAV2/2 demonstrates superior retrograde transport to spinal motor neurons compared to AAV2/1

  • Timing of intervention: Treatment before symptom onset (3 months of age in mice) produces better functional outcomes than treatment after symptom development (10 months)

  • Vector dose: While specific optimal dosing information is limited in the available data, effective protocols have utilized doses sufficient to achieve detectable paraplegin expression in spinal cord mitochondria

  • Expression monitoring: Western blot analysis of isolated mitochondria from spinal cord and skeletal muscle can confirm successful transduction and protein expression

The therapeutic window appears quite wide, as significant improvement was observed even when treatment was initiated at 10 months of age, after the onset of mitochondrial abnormalities .

How can researchers quantitatively assess neuropathological changes in Spg7-/- mice?

Quantitative assessment of neuropathological changes in paraplegin-deficient mice requires multiple analytical approaches:

  • Light microscopy analysis of semithin sections:

    • Examination of sciatic nerve cross-sections

    • Identification of axons showing inclusions, deposits, and degenerative changes

    • Morphometric analysis with randomized counting of affected axons

    • Calculation of percentage of axons showing unequivocal signs of axonopathy

  • Ultrastructural analysis via electron microscopy:

    • Assessment of mitochondrial morphology abnormalities

    • Identification of neurofilament accumulation and other aggregates

    • Quantification of axons containing abnormal mitochondria

  • Skeletal muscle analysis:

    • Evaluation of denervation signs

    • Assessment of fiber type grouping and atrophy

These complementary approaches provide comprehensive documentation of disease progression and therapeutic response at both the light and electron microscopic levels.

What techniques are available for isolating and analyzing mitochondria from Spg7-/- mouse tissues?

For researchers investigating mitochondrial abnormalities in paraplegin-deficient mice, several specialized techniques can be employed:

  • Mitochondrial isolation:

    • Differential centrifugation of tissue homogenates (skeletal muscle, spinal cord)

    • Density gradient separation for higher purity

    • Subcellular fractionation to separate synaptic and non-synaptic mitochondria

  • Western blot analysis:

    • Assessment of paraplegin expression in isolated mitochondria

    • Verification of proper processing of the protein

    • Quantification of expression levels in different tissues

  • Morphological assessment:

    • Electron microscopy to visualize mitochondrial ultrastructure

    • Quantification of abnormal mitochondria percentage in axons

    • Classification of mitochondrial morphological abnormalities

These methods allow for both functional and structural analysis of mitochondria, providing insights into the pathogenic mechanisms underlying paraplegin deficiency.

How does paraplegin replacement affect mitochondrial morphology and function in Spg7-/- models?

Paraplegin replacement therapy has demonstrated remarkable effects on mitochondrial morphology in Spg7-/- mice:

  • Morphological rescue:

    • Significant reduction in the percentage of axons containing abnormal mitochondria

    • Decrease in mitochondrial accumulation within axons, suggesting improved axonal transport

    • The percentage of axons with abnormal mitochondria in AAV2/2-Spg7 treated nerves was lower than at the time of vector administration, indicating partial reversal of pre-existing defects

  • Functional implications:

    • Improved axonal transport correlating with rescued mitochondrial morphology

    • Enhanced motor performance on rotarod tests, suggesting functional recovery

    • Long-term sustainability of the therapeutic effect (up to 10 months in published studies)

These findings provide compelling evidence that mitochondrial morphological abnormalities are reversible, even after prolonged paraplegin deficiency, highlighting the dynamic nature of these organelles and the potential for therapeutic intervention even in established disease .

What is the minimal effective dose of paraplegin required for phenotypic rescue?

While exact dose-response data is limited in the available literature, several key observations provide insight regarding minimal effective paraplegin levels:

  • Even relatively low levels of paraplegin expression appear sufficient for therapeutic benefit, consistent with the recessive nature of HSP caused by paraplegin deficiency

  • Both AAV2/1-Spg7 and AAV2/2-Spg7 vectors improved neuropathology in peripheral nerves, despite AAV2/1 producing undetectable paraplegin levels in spinal cord mitochondria by Western blot

  • This suggests that restoration of even very small amounts of paraplegin might be therapeutically meaningful

  • Complete restoration to wild-type paraplegin levels does not appear necessary for significant mitochondrial and neuropathological improvement

These observations have important implications for therapeutic development, suggesting that even partial restoration of paraplegin function may provide clinical benefit in patients with complete loss-of-function mutations.

What are the implications of mouse Spg7 studies for human HSP treatment approaches?

Research using recombinant mouse paraplegin provides several key insights with translational relevance for human HSP treatment:

  • Therapeutic window:

    • The significant lag between symptom onset and axonal loss in mouse models suggests a wide therapeutic window

    • Even intervention at "early symptomatic" stages (equivalent to 10 months in mice) can halt disease progression

    • This implies that therapeutic options might be successfully exploited for several years after diagnosis in humans

  • Delivery approach:

    • AAV-mediated gene therapy with intramuscular delivery represents a potentially feasible approach for human application

    • The ability to target central neurons through peripheral administration reduces invasiveness

    • The long-term expression achieved with AAV vectors (10+ months in mice) is promising for human therapy

  • Efficacy requirements:

    • Even partial restoration of paraplegin expression appears sufficient for therapeutic benefit

    • This lowers the efficacy threshold needed for clinical translation

These findings provide a strong preclinical foundation supporting gene therapy approaches for paraplegin-deficient HSP in humans.

How can therapeutic efficacy be monitored in Spg7 gene replacement studies?

Comprehensive assessment of therapeutic efficacy in paraplegin gene replacement studies requires a multi-modal approach:

  • Functional testing:

    • Rotarod performance evaluation (monthly testing recommended)

    • Additional motor function tests as appropriate (grip strength, gait analysis)

    • Long-term monitoring (≥10 months) to assess sustainability of effects

  • Neuropathological assessment:

    • Semithin sections of peripheral nerves with quantification of affected axons

    • Electron microscopy to evaluate mitochondrial morphology

    • Assessment of central pathways (e.g., fasciculus gracilis) to determine extent of rescue

  • Molecular verification:

    • Western blot analysis of mitochondrial fractions to confirm paraplegin expression

    • Immunohistochemistry to assess distribution of transduced neurons

    • Potential biomarkers of mitochondrial function

A comprehensive longitudinal assessment using these complementary approaches provides the most robust evaluation of therapeutic efficacy in preclinical models.

What are the critical controls required for Spg7 gene delivery experiments?

When designing gene delivery experiments with recombinant mouse paraplegin, researchers should implement the following critical controls:

  • Vector controls:

    • Contralateral limb injection with AAV-LacZ or other reporter gene vector

    • This provides an internal control within each animal, controlling for age and genetic background effects

  • Age-matched controls:

    • Untreated Spg7-/- mice at the age of intervention to establish baseline pathology

    • Continued monitoring of untreated Spg7-/- mice to document natural disease progression

    • Wild-type (Spg7+/+) mice to establish normal performance parameters

  • Time-point controls:

    • Analysis of a subset of animals at the time of vector administration to determine baseline pathology

    • This enables assessment of whether therapy merely halts progression or actually reverses existing pathology

How can researchers differentiate between halting disease progression and reversing established pathology?

Distinguishing between halting disease progression and actually reversing established pathology requires specific experimental design considerations:

  • Establish baseline pathology:

    • Analyze a cohort of age-matched Spg7-/- mice at the time of intervention

    • Document the percentage of affected axons and mitochondrial abnormalities present at treatment initiation

  • Comparative analysis:

    • Compare post-treatment pathology not only to untreated controls but also to the pre-treatment baseline

    • If post-treatment pathology shows significantly less abnormalities than the pre-treatment baseline, this suggests reversal rather than merely halting progression

  • Evidence of reversal:

    • The finding that AAV2/2-Spg7 treatment reduced the percentage of axons with abnormal mitochondria to levels lower than those present at the time of intervention strongly suggests actual reversal of pathology

    • This reversal of mitochondrial morphological abnormalities indicates that these defects are not permanent but can be rescued with restoration of paraplegin function

This distinction has important implications for therapeutic timing and potential benefits in patients with established disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.