Recombinant Mouse Peptidyl-prolyl cis-trans isomerase FKBP11 (Fkbp11)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Peptidyl-prolyl cis-trans Isomerase FKBP11 (Fkbp11)

Recombinant Mouse Peptidyl-prolyl cis-trans isomerase FKBP11 (Fkbp11) is a protein that belongs to the FK506 binding protein family, known for their peptidyl-prolyl cis-trans isomerase (PPIase) activity. This enzyme plays a crucial role in protein folding by facilitating the cis-trans isomerization of peptide bonds preceding proline residues, which is essential for the proper folding and stability of proteins.

Biological Function of FKBP11

FKBP11 is involved in various cellular processes, including the synthesis of secretory and membrane proteins. It acts as a translocon accessory factor by binding to ribosome-translocon complexes in the endoplasmic reticulum (ER), facilitating the proper folding of nascent polypeptides during their cotranslational translocation into the ER . This function is critical for maintaining protein homeostasis and preventing ER stress.

Expression and Role in Disease

FKBP11 has been identified as a potential biomarker for hepatocellular carcinoma (HCC), with its expression significantly elevated in HCC tissues compared to benign liver tissues . Additionally, FKBP11 is implicated in protecting intestinal epithelial cells against inflammation and apoptosis by regulating ER stress and inhibiting the JNK-caspase signaling pathway .

Expression Levels in HCC

Tissue TypeFKBP11 Expression Level
Benign LiverBaseline
Tumor-Adjacent1.5±0.5-fold higher
HCC2.3±1.4-fold higher

The expression levels of FKBP11 in human liver tissues show a progressive increase from benign to tumor-adjacent and HCC tissues, indicating its potential as a biomarker for HCC .

Role in ER Stress and Apoptosis

FKBP11 protects intestinal epithelial cells from apoptosis by mitigating ER stress and inhibiting the JNK-caspase signaling pathway. This is evident in studies where FKBP11 overexpression reduced apoptosis in cells treated with IFN-γ/TNF-α .

References

- Identification of FKBP11 as a Biomarker for Hepatocellular Carcinoma.
- The prolyl isomerase FKBP11 is a secretory translocon accessory factor.
- FKBP11 protects intestinal epithelial cells against inflammation.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Fkbp11; Peptidyl-prolyl cis-trans isomerase FKBP11; PPIase FKBP11; 19 kDa FK506-binding protein; 19 kDa FKBP; FKBP-19; FK506-binding protein 11; FKBP-11; Rotamase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
28-201
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Fkbp11
Target Protein Sequence
GPETESPVRTLQVETLVQPPESCTESAAIGDTLHIHYTGSLVDGRIIDTSLTRDPLVIEL GQKQVIPGLEQSLLDMCVGEKRRAVIPSHLAYGKRGYPPSIPADAVVQYDVELIALIRAN YWQKLLKSILPLVGIAMVPALLGLIGYHLYRKASRPKVSKKKLKEEKRNKSKKK
Uniprot No.

Target Background

Function
Peptidyl-prolyl cis-trans isomerases (PPIases) catalyze the isomerization of peptidyl-prolyl bonds, accelerating protein folding during protein synthesis.
Gene References Into Functions
  1. S-palmitoylation of IFITM5 promotes its interaction with FKBP11. PMID: 24058703
Database Links
Protein Families
FKBP-type PPIase family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is FKBP11 and what is its primary cellular function?

FKBP11 (also termed FKBP19) is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) FKBP family that catalyzes the isomerization of peptide bonds between proline and preceding residues, a rate-limiting step in protein folding . It functions as an antibody folding catalyst and is specifically produced by human plasma cells, with recombinant human FKBP11 demonstrating the ability to refold IgG antibody in vitro . This activity can be inhibited by FK506 (tacrolimus), supporting its function as an antibody peptidyl-prolyl cis-trans isomerase . Recent research has revealed that FKBP11 also serves as a translocon accessory factor that acts on a broad range of soluble secretory and transmembrane proteins during their synthesis at the endoplasmic reticulum (ER) .
The protein contains a N-terminal signal sequence, a PPIase domain, and a putative transmembrane domain, while lacking the calcium-binding EF-hand domain typical of several FKBP members in the secretory pathway . FKBP11 binds to ribosome-translocon complexes (RTCs) in the ER membrane, dependent on its single transmembrane domain and a conserved, positively charged region at its cytosolic C-terminus . This association with RTCs allows FKBP11 to selectively engage with ribosomes synthesizing secretory and membrane proteins that have long translocated segments, suggesting a specialized role in facilitating the folding of specific protein substrates .

How is FKBP11 expression regulated in different cell types and conditions?

FKBP11 expression demonstrates significant tissue specificity and is regulated through multiple mechanisms. It is predominantly expressed in secretory tissues including the pancreas and appears particularly important in lymphoid tissue, especially during plasma cell differentiation . Gene expression profiling studies have demonstrated upregulation of FKBP11 during differentiation from B cells to antibody-secreting plasma cells, where its expression appears to be regulated by the transcription factor X-box-binding protein 1 (XBP1) .
The regulation of FKBP11 is tightly linked to the unfolded protein response (UPR), an adaptive cellular mechanism activated during ER stress . Induction of ER stress in cell lines has been shown to trigger FKBP11 expression in an XBP1-dependent manner as part of the broader UPR . This connection to ER stress signaling is consistent with FKBP11's proposed role in helping cells cope with increased protein folding demands, particularly in professional secretory cells like plasma cells that produce large quantities of antibodies .
Interestingly, researchers have observed that FKBP11 is significantly overexpressed in B cells from patients with Systemic Lupus Erythematosus (SLE), with a mean increase of 4-fold relative to controls . This overexpression was even more pronounced (mean of 9-fold over healthy controls) in a subset of patients displaying distinct gene expression patterns related to the UPR . These findings suggest that dysregulation of FKBP11 expression may contribute to pathological conditions associated with altered protein folding or immune function.

What experimental models are available to study FKBP11 function?

Researchers have developed several experimental models to investigate FKBP11 function across different biological contexts. Cell line models include antibody-producing hybridoma cell lines, where FKBP11 knockdown studies have been performed to assess effects on antibody secretion and cell viability under normal and ER stress conditions . Alveolar epithelial cell lines have also been utilized to examine FKBP11's role in cell survival during ER stress, with deficiency increasing susceptibility to ER stress-mediated cell death .
For in vivo studies, lentiviral transgenic mice models overexpressing FKBP11 have been created to understand its biological significance in B cells and autoimmunity . These FKBP11-high mice developed lymphoid hyperplasia characterized by increased bone marrow, spleen, and lymph node cellularity, with more pronounced effects in B cell populations . Such models allow researchers to examine the physiological consequences of altered FKBP11 expression within the complex environment of a living organism.
Knockout or knockdown approaches have been employed to assess FKBP11's functional significance in cellular processes. For instance, knockdown of FKBP11 in cells has revealed its importance for the stability of specific proteins like EpCAM and PTTG1IP, suggesting its role in proper folding and maturation of certain secretory and membrane proteins . Additionally, researchers can utilize recombinant FKBP11 proteins for in vitro studies, including those conjugated to magnetic beads, which facilitate various applications such as immunoassays, protein purification, and interaction studies .

What role does FKBP11 play in antibody folding and B cell function?

FKBP11 has emerged as a critical component in the antibody production machinery of plasma cells, with multiple lines of evidence supporting its role as an antibody folding catalyst. Recombinant human FKBP11 demonstrates the ability to refold IgG antibody in vitro through its peptidyl-prolyl cis-trans isomerase activity, which can be specifically inhibited by FK506 (tacrolimus) . This activity is crucial because the isomerization of peptide bonds involving proline residues represents a rate-limiting step in protein folding, particularly for complex multi-domain proteins like antibodies .
Experimental evidence suggests significant redundancy in the ER-resident folding machinery of antibody-producing cells. When FKBP11 was knocked down in an antibody-producing hybridoma cell line, researchers observed neither induced cell death nor decreased expression or secretion of IgG antibody . Similarly, antibody secretion by the same hybridoma cell line was not affected by knockdown of the established antibody peptidyl-prolyl isomerase cyclophilin B, indicating functional redundancy among ER-resident folding factors . This redundancy likely ensures robust antibody production even when individual components of the folding machinery are compromised.
Overexpression studies in mice have revealed that elevated FKBP11 levels result in B cell hyperplasia and enhanced immune responses. FKBP11-high mice demonstrate increased bone marrow, spleen, and lymph node cellularity, with more pronounced effects on B cell populations . These mice also show enhanced B cell proliferation after stimulation with lipopolysaccharide (LPS) in vitro and amplified antibody responses to T-independent antigens like NP-LPS in vivo . Additionally, at baseline, FKBP11-high mice produce significantly higher levels of serum IgG3 compared to control mice, although other immunoglobulin isotypes remain unchanged . These findings suggest that FKBP11 may be a limiting factor in certain aspects of B cell proliferation and antibody production under specific conditions.

How does FKBP11 interact with the ribosome-translocon complex?

FKBP11 functions as a secretory translocon accessory factor by binding directly to ribosome-translocon complexes (RTCs) in the ER membrane . This interaction is dependent on FKBP11's single transmembrane domain and a conserved, positively charged region at its cytosolic C-terminus, which likely mediates specific protein-protein interactions with components of the translocon . Through this association, FKBP11 is strategically positioned to act on nascent polypeptides as they emerge from the translocon into the ER lumen, allowing it to facilitate proper folding from the earliest stages of protein synthesis .
High-throughput mRNA sequencing has revealed that FKBP11 selectively engages with ribosomes synthesizing secretory and membrane proteins with long translocated segments . This selectivity suggests that FKBP11 may recognize specific features or folding challenges presented by these types of proteins, possibly related to their size, domain organization, or proline content . Functional analysis has demonstrated reduced stability of two such proteins, EpCAM and PTTG1IP, in cells depleted of FKBP11, providing direct evidence for its role in supporting the proper folding and maturation of specific client proteins .
As a metazoan-specific protein, FKBP11 appears to have evolved to meet the increased demands for protein folding in complex multicellular organisms . Its specialized function at the translocon represents an adaptation that allows for efficient co-translational folding of secretory and membrane proteins, which are particularly important for cell-cell communication, tissue organization, and immune function in metazoans . This spatial and functional organization positions FKBP11 as an integral component of the ER protein folding network, working in concert with other chaperones and folding enzymes to ensure the proper maturation of secretory pathway proteins.

What is the relationship between FKBP11 and ER stress/Unfolded Protein Response (UPR)?

FKBP11 is intricately linked to the cellular response to ER stress through the Unfolded Protein Response (UPR) pathway. Research has demonstrated that FKBP11 expression is induced during ER stress in an XBP1-dependent manner, positioning it as a downstream effector of the UPR . This regulation is particularly significant as XBP1 is a key transcription factor activated during the UPR, responsible for upregulating genes involved in protein folding, quality control, and ER-associated degradation . The induction of FKBP11 under ER stress conditions suggests it plays a role in alleviating protein folding stress by enhancing the cell's capacity to handle increased folding demands.
Deficiency of FKBP11 increases susceptibility to ER stress-mediated cell death in alveolar epithelial cell lines, indicating its importance for cell survival under conditions of protein folding stress . This protective role may be particularly crucial in secretory cells that naturally experience high ER protein load, such as plasma cells, pancreatic cells, and hepatocytes . By facilitating proper protein folding through its peptidyl-prolyl isomerase activity, FKBP11 likely helps to reduce the burden of misfolded proteins that could otherwise trigger ER stress and cell death pathways.
Gene expression analyses of B cells from SLE patients have revealed a subset of patients with highly elevated FKBP11 expression (approximately 9-fold increase compared to controls) who also display upregulation of many other genes implicated in the UPR . This correlation suggests that FKBP11 overexpression may be part of a broader UPR signature associated with certain autoimmune conditions . Understanding the relationship between FKBP11, ER stress, and autoimmunity could provide insights into the cellular mechanisms underlying these diseases and potentially identify new therapeutic targets.

How does overexpression of FKBP11 affect B cell development and immune responses?

Overexpression of FKBP11 in transgenic mice leads to significant changes in B cell development and function, providing insights into its potential role in normal and pathological immune responses. FKBP11-high mice develop lymphoid hyperplasia characterized by increased cellularity in the bone marrow, spleen, and lymph nodes . While this increase occurs across all characterized B and T-cell subpopulations, it is more pronounced in B cells, suggesting a particular sensitivity of the B cell lineage to FKBP11 levels . Despite this hyperplasia, the basal activation state of B and T cells remains unaltered in FKBP11-high mice, as measured by the ex vivo expression of activation markers .
At the functional level, B cells from FKBP11-high mice demonstrate enhanced proliferative responses to LPS stimulation in vitro compared to cells from littermate control mice . This increased proliferative capacity correlates with the in vivo lymphoid hyperplasia observed in these animals . Moreover, FKBP11-high mice produce significantly higher levels of serum IgG3 under baseline conditions, although levels of other immunoglobulin isotypes (IgM, IgG, IgG1, and IgG2b) remain comparable to control mice . These findings suggest that FKBP11 may selectively influence specific aspects of B cell function or certain immunoglobulin classes.
Immune challenge experiments have revealed that FKBP11 overexpression enhances responses to certain antigens while leaving others unaffected. While the total IgG and IgG1 responses to the T-dependent antigen ovalbumin (OVA) were unaffected by FKBP11 overexpression, FKBP11-high mice mounted significantly amplified antibody responses to the T-independent antigen NP-LPS compared to control mice . This selective enhancement of T-independent responses suggests that FKBP11 may play a more critical role in certain B cell activation pathways, particularly those that don't rely heavily on T cell help .

What is the potential role of FKBP11 in disease pathogenesis?

FKBP11 has been implicated in multiple disease contexts, with its dysregulation potentially contributing to both autoimmune and neoplastic conditions. In Systemic Lupus Erythematosus (SLE), a severe systemic autoimmune disease characterized by autoantibody-mediated inflammation, FKBP11 is significantly overexpressed in B cells from patients compared to healthy controls . This overexpression is particularly pronounced (approximately 9-fold increase) in a subset of patients displaying a distinct gene expression profile enriched for Unfolded Protein Response (UPR) components . The connection between FKBP11 overexpression and SLE is further supported by transgenic mouse models, where FKBP11 overexpression leads to lymphoid hyperplasia and enhanced B cell responses to certain antigens .
In the context of liver diseases, FKBP11 has been identified as a potential biomarker for hepatocellular carcinoma (HCC) . Studies have observed a significantly and progressively elevated expression of FKBP11 from benign liver to tumor-adjacent tissue (1.5±0.5-fold higher) and then to HCC (2.3±1.4-fold higher) . This stepwise increase suggests that FKBP11 upregulation may be an early event in hepatocarcinogenesis and could potentially serve as a marker for disease progression . Additionally, FKBP11 overexpression has been associated with viral hepatitis, with significantly elevated levels observed in tumor-adjacent tissues from patients with hepatitis B or C virus infections compared to those without viral hepatitis .
FKBP11's role in Idiopathic Pulmonary Fibrosis (IPF) has also been investigated, with research showing increased expression of FKBP11 in IPF lungs, specifically localized to antibody-producing plasma cells . This finding is particularly interesting given the emerging evidence for a potential role of autoimmunity in IPF pathogenesis, including reports of higher levels of circulating plasmablasts, soluble factors promoting B cell growth and differentiation, and various autoantibodies toward lung antigens in IPF patients . Understanding FKBP11's function in plasma cells could therefore provide insights into the mechanisms underlying autoantibody production in IPF and potentially identify new therapeutic targets.

What are the optimal approaches for studying FKBP11's peptidyl-prolyl isomerase activity in vitro?

Studying FKBP11's peptidyl-prolyl isomerase (PPIase) activity requires specialized methodologies that can detect and quantify the cis-trans isomerization of peptide bonds. Researchers have successfully demonstrated FKBP11's PPIase activity using recombinant human FKBP11 and IgG antibody as a substrate, showing that it can facilitate the refolding of IgG in vitro . This activity can be specifically inhibited by FK506 (tacrolimus), providing a pharmacological tool to validate and manipulate FKBP11 function in experimental settings . When designing similar assays, researchers should consider using purified recombinant FKBP11 and well-characterized substrate proteins with known proline residues critical for folding.
For more precise kinetic measurements of PPIase activity, researchers can employ chromogenic or fluorogenic peptide substrates containing a proline residue. These assays typically monitor the change in spectroscopic properties as the peptide undergoes cis-trans isomerization, allowing for real-time quantification of enzymatic activity. When adapting such assays for FKBP11, it's important to optimize buffer conditions, substrate concentrations, and detection parameters to ensure sensitivity and specificity for this particular isomerase .
To investigate the substrate specificity of FKBP11, researchers can combine in vitro activity assays with structural approaches and computational modeling. High-throughput mRNA sequencing has revealed that FKBP11 selectively engages with ribosomes synthesizing secretory and membrane proteins with long translocated segments . Based on this finding, researchers might design peptide or protein substrates mimicking these specific client proteins to better understand FKBP11's substrate preferences and catalytic mechanism. Additionally, site-directed mutagenesis of key residues in FKBP11's PPIase domain can help identify amino acids critical for catalytic activity and substrate binding, providing insights into its molecular mechanism of action.

What experimental systems are recommended for investigating FKBP11 function in vivo?

Several experimental systems have proven valuable for investigating FKBP11 function in vivo, each offering distinct advantages depending on the specific research questions. Transgenic mouse models overexpressing FKBP11, particularly in B cells, have successfully demonstrated the effects of elevated FKBP11 levels on lymphoid development and immune responses . These models revealed lymphoid hyperplasia, enhanced B cell proliferation, increased serum IgG3 levels, and amplified antibody responses to T-independent antigens . For researchers studying FKBP11's role in B cell function or autoimmunity, similar transgenic approaches using cell-type specific promoters could provide valuable insights into tissue-specific functions.
Complementary to overexpression models, knockout or conditional knockout mice would be instrumental in determining the necessity of FKBP11 for normal development and physiological processes. While complete FKBP11 knockout models have not been extensively described in the literature, inducible or tissue-specific knockout systems would be particularly valuable for distinguishing between developmental and acute functional roles of FKBP11 . These approaches could employ Cre-loxP technology to delete FKBP11 in specific cell types or at defined time points, minimizing compensatory adaptations that often confound conventional knockout studies.
For exploring FKBP11's role in disease contexts, researchers should consider disease-specific models that recapitulate relevant pathological features. In autoimmune disease research, crossing FKBP11 transgenic or knockout mice with established models of SLE or other autoimmune conditions could reveal interactions between FKBP11 expression and disease progression . Similarly, for cancer studies, FKBP11 modulation in hepatocellular carcinoma models might provide insights into its potential role in tumorigenesis, given its progressive upregulation observed in human HCC samples . In all cases, careful phenotyping should include analyses of relevant cell populations, protein folding status, ER stress markers, and functional outcomes appropriate to the disease model.

How can recombinant FKBP11 be produced and applied in experimental settings?

Production of high-quality recombinant FKBP11 is essential for many experimental applications, including structural studies, activity assays, and the development of research tools. Recombinant mouse FKBP11 has been successfully expressed in mammalian expression systems such as HEK293 cells, which provide appropriate post-translational modifications and protein folding machinery . When designing expression constructs, researchers should consider including purification tags (such as His-tag or GST-tag) that can be removed enzymatically if needed, especially for structural or functional studies where tags might interfere with native protein activity .
For application in experimental settings, recombinant FKBP11 can be conjugated to various matrices for specialized research applications. Pre-coupled magnetic beads with uniform particle size and narrow size distribution provide a convenient platform for applications such as immunoassays, in vitro diagnostics, cell sorting, immunoprecipitation/co-precipitation, and protein/antibody separation and purification . These ready-to-use preparations offer large surface areas conducive to fast capturing of target molecules with high specificity while enabling magnetic separation, and they can be integrated with automation equipment for high-throughput operations .
When working with recombinant FKBP11, researchers should carefully consider storage and handling conditions to maintain protein stability and activity. Recombinant mouse FKBP11 protein pre-coupled to magnetic beads has been reported to remain stable for at least six months when stored at 2-8°C under proper handling conditions, with recommendations against freeze-thaw cycles that could compromise bead integrity . For solution-based applications of purified recombinant FKBP11, buffer composition should be optimized to maintain protein solubility and catalytic activity, potentially including stabilizers like glycerol or reducing agents depending on the presence and importance of cysteine residues in the protein .

What are the emerging therapeutic applications targeting FKBP11?

FKBP11's role in antibody folding and B cell function positions it as a potential therapeutic target for autoimmune diseases characterized by pathogenic autoantibody production. Given that FKBP11 is overexpressed in B cells from SLE patients and that transgenic mice with elevated FKBP11 levels show enhanced B cell responses, developing specific inhibitors of FKBP11 might provide a novel approach to modulating autoantibody production . Unlike current B cell-depleting therapies such as rituximab (which targets CD20 on B cells but has limited impact on plasma cells), FKBP11 inhibitors could potentially affect antibody-secreting plasma cells directly, offering complementary therapeutic strategies for autoimmune conditions .
The sensitivity of FKBP11 to FK506 (tacrolimus) suggests a possible starting point for developing more selective inhibitors . While FK506 itself is a broad immunosuppressant that targets multiple FKBP family members and ultimately inhibits calcineurin signaling, structure-based drug design could potentially yield compounds that selectively target FKBP11's PPIase domain without affecting other FKBPs or downstream signaling pathways . Such selective inhibitors would need to be carefully evaluated for their effects on normal antibody production, as complete inhibition might compromise protective immunity while partial inhibition might be sufficient to reduce pathogenic autoantibody levels.
Beyond autoimmunity, FKBP11's progressive upregulation in hepatocellular carcinoma suggests potential applications in cancer diagnostics or therapeutics . The significantly elevated expression of FKBP11 from benign liver to tumor-adjacent tissue and then to HCC tissue provides a stepwise marker that could potentially aid in early detection or monitoring of disease progression . Additionally, understanding the functional consequences of FKBP11 overexpression in cancer cells might reveal whether it represents a passenger change or actively contributes to tumorigenesis, possibly by enhancing the folding of specific oncoproteins or stress adaptation mechanisms.

How might advances in FKBP11 research inform our understanding of protein folding disorders?

The study of FKBP11 provides a unique window into specialized protein folding mechanisms, particularly for complex secretory proteins like antibodies. As research continues to elucidate FKBP11's substrate specificity and catalytic mechanism, these insights could enhance our broader understanding of how cells manage protein folding challenges and how these processes might fail in disease states . Particularly valuable would be studies identifying the specific protein substrates that are most dependent on FKBP11 for proper folding, as this might reveal common structural features or folding challenges that require specialized PPIase activity.
FKBP11's connection to the UPR through XBP1-dependent regulation positions it within a critical cellular stress response pathway implicated in numerous diseases . Further research on how FKBP11 is regulated during different types of ER stress and how it contributes to stress adaptation could provide insights relevant to conditions ranging from neurodegenerative diseases to diabetes, where ER stress plays a pathogenic role. Of particular interest would be studies examining whether specific UPR branches or stress conditions preferentially upregulate FKBP11 and whether its activity helps resolve certain types of protein folding challenges more effectively than others.
Finally, FKBP11's role as a translocon accessory factor opens new questions about the coordination between protein synthesis and folding in the secretory pathway . Understanding how FKBP11 selectively engages with ribosomes synthesizing particular types of proteins and how it facilitates their co-translational folding could reveal broader principles about quality control mechanisms in the ER . This research direction might also identify new therapeutic opportunities for diseases characterized by protein trafficking defects or misfolding in the secretory pathway, potentially by enhancing co-translational folding efficiency or preventing premature degradation of slowly-folding but potentially functional proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.