Recombinant Mouse Peptidyl-prolyl cis-trans isomerase FKBP8 (Fkbp8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
Fkbp8; Fkbp38; Sam11; Peptidyl-prolyl cis-trans isomerase FKBP8; PPIase FKBP8; 38 kDa FK506-binding protein; 38 kDa FKBP; FKBP-38; mFKBP38; FK506-binding protein 8; FKBP-8; FKBPR38; Rotamase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-402
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Fkbp8
Target Protein Sequence
MASWAEPSEPAALRLPGAPLLEGFEVLDGVDDAEEEDDLSGLPPLEDMGQPTVEEAEQPG ALAREFLAATEPEPAPAPAPEEWLDILGNGLLRMKTLVPGPKGSSRPLKGQVVTVHLQMS LENGTRVQEEPELAFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPP HAALCLEVTLKTAEDGPDLEMLSGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKA ITSNTKVDMTCEEEEELLQLKVKCLNNLAASQLKLDHYRAALRSCSQVLEHQPDNIKALF RKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKRAAQRSTETALYRKMLGN PSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN
Uniprot No.

Target Background

Function

Recombinant Mouse Peptidyl-prolyl cis-trans isomerase FKBP8 (Fkbp8) is a constitutively inactive peptidyl-prolyl isomerase that becomes active upon binding to calmodulin and calcium. It functions as a chaperone for BCL2, targeting it to the mitochondria and modulating its phosphorylation state. The BCL2/FKBP8/calmodulin/calcium complex likely interferes with BCL2's interaction with its targets. Therefore, the active form of FKBP8 may regulate apoptosis. FKBP8 is essential for normal embryonic development.

Gene References Into Functions

Functional Studies of FKBP8:

  1. The FKBP38-ANKMY2 axis plays a key role in regulating Shh signaling in vivo. PMID: 25077969
  2. Differential gene expression analysis in FKBP8Gt((neo)) mouse embryos identified 54 differentially expressed genes (25 downregulated, 29 upregulated). PMID: 23024056
  3. FKBP8 expression is observed in the tectorial membrane during pre-hearing development, correlating with the expression of alpha- and beta-tectorin. PMID: 22178952
  4. Systemic gene transfer studies in tumor-bearing mice revealed anti-invasive and antimetastatic functions for FKBP8 and FKBP1A. PMID: 14612567
  5. FKBP8 acts as an essential antagonist of sonic hedgehog signaling in central nervous system development. PMID: 15105374
  6. FKBP38 anchors the 26S proteasome to the organellar membrane. PMID: 17573772
  7. FKBP8 disruption perturbs the expression of neural tube patterning genes, indicating a role in dorso-ventral patterning. PMID: 18003640
  8. FKBP38's anti-apoptotic activity and regulation of neurite extension are crucial for neuroectodermal organization during neural tube formation. PMID: 18459960
  9. FKBP8 disruption activates the Shh signaling pathway in a Gli2 and Kif3a-dependent manner. PMID: 18590716
  10. PHD2 protein stability is regulated by a ubiquitin-independent proteasomal pathway involving FKBP38 as an adaptor protein. PMID: 19546213
Database Links
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein; Cytoplasmic side.
Tissue Specificity
Detected throughout the embryonic body, in caudal neural tube, limbs and head. Detected in adult retina, brain, heart, kidney, liver, pancreas, lung, testis and urinary bladder (at protein level). Detected in adult brain, kidney, liver, testis and trigemi

Q&A

What is the structural composition of FKBP8 and how does it differ from other FK506-binding proteins?

FKBP8 possesses a unique structural organization that distinguishes it from other FKBP family members. The protein contains an N-terminal glutamate-rich domain (ERD), a peptidylprolyl isomerase (PPI) domain, three tetratricopeptide repeat (TPR) motifs, a Ca²⁺-calmodulin-binding region, and a C-terminal transmembrane domain that anchors it to the outer mitochondrial membrane (OMM). Unlike canonical FKBPs, FKBP8 is considered noncanonical because its PPIase activity is only triggered when Ca²⁺-bound calmodulin binds to it . The C-terminal transmembrane domain anchors FKBP8 to the OMM, positioning the N-terminal portion toward the cytosol . This structural arrangement is critical for FKBP8's diverse functions in protein interactions and cellular signaling.

For experimental analysis of FKBP8's structural domains, researchers can employ domain-deletion constructs to identify which regions are essential for specific protein-protein interactions, as demonstrated in yeast-2-hybrid assays examining FKBP8-MLCK1 interactions .

How does FKBP8 function in normal cellular homeostasis?

FKBP8 serves as an important anti-apoptotic protein by interacting with Bcl-2 and Bcl-XL, recruiting them to mitochondria . It also functions as an inhibitor of mTOR, which is antagonized by Rheb in response to growth factors or nutrients, establishing a cross-talk with Bcl-2 and Bcl-XL in this regulatory pathway . Additionally, FKBP8 acts as a chaperone for BCL2, targeting it to mitochondria and modulating its phosphorylation state .

In cardiac tissue, FKBP8 plays a protective role against hemodynamic stress, as evidenced by studies with cardiac-specific FKBP8-deficient mice that exhibited left ventricular dysfunction and chamber dilatation after pressure overload . FKBP8 also contributes to intestinal epithelial barrier integrity through its interaction with myosin light chain kinase 1 (MLCK1) .

Methods to study FKBP8's homeostatic functions include tissue-specific knockout models, protein-protein interaction assays, and functional readouts such as cell viability assays, mitochondrial membrane potential measurements, and barrier function tests.

What is the mechanism by which FKBP8 induces Parkin-independent mitophagy?

FKBP8 induces Parkin-independent mitophagy through its LC3-interacting region (LIR) motif located at its N-terminus. This LIR motif mediates binding to LC3A with high affinity, facilitating the recruitment of lipidated LC3A to damaged mitochondria . The FKBP8-LC3A interaction is LIR-dependent and is crucial for the initiation of mitophagy in the absence of Parkin.

Co-expression studies have demonstrated that FKBP8 and LC3A together profoundly induce mitophagy, even without Parkin involvement . Interestingly, FKBP8 escapes degradation during this process by translocating from mitochondria, allowing it to potentially initiate multiple rounds of mitophagy .

For researchers investigating this mechanism, experimental approaches should include:

  • Co-immunoprecipitation experiments with wild-type and LIR-mutated FKBP8 constructs

  • Live-cell imaging with fluorescently tagged FKBP8 and LC3A

  • Mitophagy reporter assays (e.g., using mCherry-GFP-OMP25TM)

  • Electron microscopy to visualize mitophagy events

How does the FKBP8-LC3A interaction compare with other mitophagy receptor-ATG8 family member interactions?

Different mitophagy receptors show preferences for specific ATG8 family members. FKBP8 demonstrates a strong affinity for LC3A both in vitro and in vivo, with moderate binding to LC3B and weaker interactions with other ATG8 proteins in cellular contexts . In contrast, NIX preferentially recruits GABARAPL1, while Bcl-2-L13, BNIP3, and FUNDC1 preferentially interact with LC3B .

This preferential recruitment pattern is reflected in the efficiency with which different receptor-ATG8 pairs induce mitophagy, as shown in the table below based on studies with mitophagy reporter assays:

Mitophagy ReceptorPreferred ATG8 PartnerRelative Mitophagy Efficiency
FKBP8LC3AHigh
NIXGABARAPL1Moderate
BNIP3LC3BModerate
FUNDC1LC3BModerate
Bcl-2-L13LC3BModerate

To investigate these interactions, researchers should employ:

  • GST-pulldown assays with recombinant proteins

  • Co-immunoprecipitation experiments in relevant cell lines

  • Binding affinity measurements using techniques like isothermal titration calorimetry

  • Functional mitophagy assays comparing different receptor-ATG8 combinations

What are the most reliable methods for measuring FKBP8 expression and activity in mouse tissue samples?

For quantifying FKBP8 protein levels in mouse tissues, several complementary approaches are recommended:

  • ELISA: Mouse Peptidyl-prolyl cis-trans isomerase FKBP8 ELISA kits provide a sensitive method (detection range: 0.625-40 ng/mL; sensitivity: 0.322 ng/mL) for measuring FKBP8 in serum, plasma, and cell lysates . These assays typically employ the sandwich ELISA technique with intra- and inter-assay CV values of 6.3% and 8.2%, respectively .

  • Western Blotting: This technique allows visualization of FKBP8 protein expression and potential post-translational modifications. Researchers should use validated antibodies and include appropriate controls.

  • qRT-PCR: For mRNA expression analysis, design primers specific to mouse Fkbp8 and normalize to stable reference genes.

  • Immunohistochemistry/Immunofluorescence: These techniques enable visualization of FKBP8 localization within tissues and cells.

For measuring FKBP8 PPIase activity, researchers can use:

  • Calmodulin-dependent PPIase activity assays, noting that FKBP8's PPIase activity requires Ca²⁺-bound calmodulin

  • Chaperone activity assays to assess FKBP8's functional role in protein folding

What are the critical considerations when designing experiments with recombinant mouse FKBP8?

When working with recombinant mouse FKBP8, researchers should consider:

  • Expression System Selection: Bacterial expression systems may not provide proper post-translational modifications. Mammalian expression systems are preferred for functional studies.

  • Domain Integrity: Ensure all functional domains (ERD, PPI, TPR, Ca²⁺-calmodulin-binding region, and transmembrane domain) are properly folded and intact. Domain-deletion constructs should be considered for structure-function studies .

  • Proper Controls:

    • Wild-type FKBP8 vs. LIR mutant for mitophagy studies

    • Domain deletion constructs (ΔERD, ΔPPI, ΔTPR, ΔTM) for interaction studies

    • Catalytically inactive mutants for enzymatic studies

  • Subcellular Localization: The C-terminal transmembrane domain is critical for proper mitochondrial localization. C-terminal tags may disrupt this localization.

  • Activation Requirements: Remember that FKBP8's PPIase activity requires Ca²⁺-calmodulin binding .

  • Interaction Partners: Consider co-expression with known binding partners (LC3A, MLCK1, Bcl-2) when assessing functional activity .

How does FKBP8 protect cardiomyocytes from stress-induced damage?

FKBP8 plays a crucial protective role in the heart, particularly under conditions of hemodynamic stress. Cardiac-specific FKBP8-deficient (Fkbp8⁻/⁻) mice show normal cardiac phenotypes under baseline conditions but develop severe left ventricular dysfunction and chamber dilatation with lung congestion when subjected to pressure overload via transverse aortic constriction (TAC) .

The protective mechanism involves preventing apoptosis in cardiomyocytes under stress conditions. FKBP8 deficiency leads to dramatically elevated numbers of apoptotic cardiomyocytes after TAC, accompanied by increased protein levels of cleaved caspase-12 and endoplasmic reticulum (ER) stress markers . Inhibition of caspase-12 attenuates hydrogen peroxide-induced apoptotic cell death in FKBP8 knockdown H9c2 myocytes, suggesting that FKBP8 protects cardiomyocytes partly by preventing caspase-12 activation and ER stress-induced apoptosis .

Research methods to investigate this protective function include:

  • Cardiac-specific knockout models

  • Pressure overload models (e.g., TAC)

  • Echocardiographic assessment of cardiac function

  • TUNEL assays for apoptosis detection

  • Western blotting for ER stress markers and caspase activation

  • Cardiomyocyte cell culture models with FKBP8 knockdown/overexpression

What experimental models are most suitable for studying FKBP8's role in cardiac function?

Several experimental models can be employed to study FKBP8's role in cardiac function:

  • In Vivo Models:

    • Cardiac-specific FKBP8 knockout mice (Fkbp8⁻/⁻)

    • Pressure overload models (transverse aortic constriction)

    • Ischemia-reperfusion injury models

    • Heart failure models

  • In Vitro Models:

    • Primary cardiomyocyte cultures with FKBP8 knockdown or overexpression

    • H9c2 cardiac myoblast cell line with modulated FKBP8 expression

    • HL-1 cardiomyocyte cell line

  • Ex Vivo Models:

    • Langendorff perfused heart preparations

    • Cardiac tissue slices

For physiological assessments:

  • Echocardiography for cardiac function

  • Pressure-volume loop analysis for hemodynamic parameters

  • Electrocardiography for electrical activity

  • Histopathological examination for structural changes

For molecular assessments:

  • Western blotting for ER stress markers, caspase activation

  • qRT-PCR for gene expression changes

  • Immunohistochemistry for protein localization

  • TUNEL assays for apoptosis detection

Note that complete Fkbp8 knockout mice suffer from embryonic lethality , making tissue-specific knockout models particularly valuable.

How does FKBP8 contribute to intestinal epithelial barrier regulation?

FKBP8 plays a critical role in intestinal epithelial barrier regulation through its interaction with myosin light chain kinase 1 (MLCK1). FKBP8 directs MLCK1-dependent barrier regulation and has been identified as a potential therapeutic target in Crohn's disease .

The specific mechanism involves:

  • Protein-Protein Interaction: FKBP8 interacts with MLCK1 via its peptidylprolyl isomerase (PPI) domain. This interaction is specific to MLCK1 and does not occur with MLCK2 .

  • TNF-Induced Recruitment: Upon TNF stimulation, MLCK1-FKBP8 interactions increase significantly (3.1±0.1-fold), as demonstrated by proximity ligation assays .

  • Scaffolding Function: FKBP8 functions as a multi-domain scaffold that links MLCK1 to other proteins involved in perijunctional recruitment. Expression of either the free PPI domain or a FKBP8 deletion mutant lacking the PPI domain acts as dominant negative inhibitors of TNF-induced MLCK1 recruitment and barrier loss .

  • Barrier Regulation: FKBP8 is essential for both basal and TNF-induced MLCK1 recruitment and associated barrier regulation. Knockout of FKBP8 in epithelial cells prevents TNF-induced MLCK1 recruitment and barrier loss .

Research methodologies to study this function include:

  • Transepithelial electrical resistance (TER) measurements

  • Proximity ligation assays for protein-protein interactions

  • Expression of domain-specific mutants

  • Cell line models with FKBP8 knockout or knockdown

What is the potential of FKBP8 as a therapeutic target in inflammatory bowel diseases?

FKBP8 represents a promising therapeutic target for inflammatory bowel diseases, particularly Crohn's disease, based on its role in intestinal barrier regulation . The rationale includes:

  • Barrier Dysfunction Mechanism: FKBP8 directs MLCK1-dependent barrier regulation, which is disrupted in inflammatory conditions. Targeting FKBP8 could help restore barrier function without immunosuppression .

  • In Vivo Evidence: Tacrolimus, which interacts with FKBP8, blocks T cell activation-induced MLCK1 recruitment, MLC phosphorylation, and barrier loss when delivered luminally, without affecting mucosal immune activation .

  • Selective Targeting: Monofunctional FKBP inhibitors that do not inhibit calcineurin and are not immunosuppressive have been developed, including one that specifically targets FKBP8 . These could potentially serve as non-immunosuppressive barrier restorative agents.

Experimental approaches to investigate FKBP8 as a therapeutic target include:

  • In vitro barrier function models with FKBP8 modulators

  • Ex vivo intestinal tissue models

  • Animal models of intestinal inflammation

  • Testing of specific FKBP8 inhibitors in preclinical models

  • Combination approaches with existing IBD therapeutics

The table below summarizes key findings regarding FKBP8 modulation in intestinal barrier function:

Experimental ConditionEffect on MLCK1 RecruitmentEffect on Barrier FunctionReference
FKBP8 KnockoutPreventedImproved baseline, prevented TNF-induced loss
FKBP8 PPI Domain ExpressionReducedIncreased TER
FKBP8 ΔPPI ExpressionReducedIncreased basal TER, prevented TNF-induced loss
Luminal TacrolimusBlockedPrevented T cell activation-induced loss

How can researchers effectively study the selective interaction between FKBP8 and various ATG8 family members?

To investigate the selective interaction between FKBP8 and ATG8 family members (particularly its preference for LC3A), researchers should employ a multi-methodological approach:

  • In Vitro Binding Assays:

    • GST-pulldown assays with recombinant GST-tagged ATG8 proteins and in vitro-translated FKBP8 (wild-type and LIR-mutant)

    • Surface plasmon resonance or isothermal titration calorimetry to determine binding affinities

    • Structural studies using X-ray crystallography or NMR spectroscopy

  • Cellular Interaction Studies:

    • Co-immunoprecipitation experiments with GFP-tagged ATG8 proteins and Flag-tagged FKBP8

    • Proximity ligation assays to detect interactions in situ

    • FRET-based interaction assays

  • Functional Assessments:

    • Mitophagy reporter assays with different combinations of FKBP8 and ATG8 family members

    • Live-cell imaging of fluorescently tagged proteins

    • Mitochondrial morphology and function assessments

  • Structure-Function Analysis:

    • Mutagenesis of the LIR motif or other domains

    • Chimeric proteins with domains swapped between different mitophagy receptors

    • Computational modeling of interaction interfaces

According to published research, FKBP8 shows differential binding to ATG8 family members:

  • Strong affinity for LC3A and GABARAPL1 in vitro

  • Strong interaction with LC3A, moderate with LC3B, and weak with GABARAP in cellular contexts

  • Low-affinity binding toward GABARAPL2 and LC3C

This selective interaction pattern supports a model where different mitophagy receptors engage specific ATG8 family members to facilitate effective mitophagy under various cellular conditions.

What are the current challenges and future directions in studying FKBP8's role in cellular homeostasis?

Current challenges and future research directions for FKBP8 include:

  • Redundancy and Compensation Mechanisms:

    • Understanding the interplay or redundancy between FKBP8 and other mitophagy receptors (BNIP3, NIX, FUNDC1, Bcl2-L13) in mitochondrial quality control

    • Determining whether specific conditions preferentially activate particular mitophagy receptors

    • Developing models to study compensatory mechanisms in FKBP8-deficient systems

  • Translational Research Challenges:

    • The embryonic lethality of complete Fkbp8 knockout mice limits whole-organism studies

    • Developing tissue-specific and inducible knockout models for temporal control

    • Identifying specific FKBP8 modulators without off-target effects

  • Molecular Mechanism Questions:

    • How does FKBP8 escape degradation during mitophagy?

    • What determines the preferential recruitment of LC3A over other ATG8 family members?

    • What is the full complement of FKBP8 interaction partners in different cellular compartments?

  • Disease Relevance:

    • Further investigating FKBP8's role in cancer, neurodegenerative disorders, and autoimmune conditions

    • Determining whether FKBP8 dysfunction contributes to mitochondrial diseases

    • Exploring the therapeutic potential of FKBP8 modulation in various disease contexts

  • Technical Advances Needed:

    • Development of specific antibodies against different FKBP8 post-translational modifications

    • Creation of biosensors to monitor FKBP8 activity in real-time

    • High-throughput screening methods for FKBP8 modulators

Future research directions should focus on integrating FKBP8's various functions (mitophagy regulation, anti-apoptotic activity, barrier regulation) into a comprehensive model of how this multifunctional protein contributes to cellular homeostasis across different tissues and under various stress conditions.

What are common pitfalls in FKBP8 detection and functional assays, and how can they be resolved?

Researchers working with FKBP8 may encounter several experimental challenges:

  • Antibody Specificity Issues:

    • Problem: Cross-reactivity with other FKBP family members.

    • Solution: Validate antibodies using FKBP8 knockout controls; use epitope tags when possible; perform peptide competition assays to confirm specificity.

  • Subcellular Localization Artifacts:

    • Problem: Overexpression can alter natural localization patterns.

    • Solution: Use endogenous protein detection methods; employ stable expression at near-physiological levels; confirm localization with multiple methodologies.

  • PPIase Activity Measurement:

    • Problem: FKBP8's PPIase activity requires Ca²⁺-calmodulin binding.

    • Solution: Ensure proper Ca²⁺ and calmodulin are present in assay conditions; include appropriate positive and negative controls.

  • FKBP8-LC3 Interaction Studies:

    • Problem: Weak or variable detection of interactions.

    • Solution: Use appropriate cell lysis conditions that preserve membrane protein interactions; consider proximity ligation assays for in situ detection; use LIR-mutant FKBP8 as a negative control .

  • Mitophagy Assays:

    • Problem: Distinguishing FKBP8-mediated mitophagy from other mitophagy pathways.

    • Solution: Perform experiments in Parkin-deficient cells; use multiple mitophagy detection methods (reporter assays, Western blotting for mitochondrial proteins, electron microscopy).

  • ELISA Detection:

    • Problem: Matrix effects in complex samples.

    • Solution: Prepare standard curves in matrix-matched solutions; validate dilution linearity; consider sample clean-up procedures.

How can researchers effectively distinguish between FKBP8's direct effects and its scaffolding functions?

Distinguishing between direct enzymatic effects and scaffolding functions of FKBP8 requires strategic experimental approaches:

  • Domain-Specific Mutants:

    • Express domain deletion constructs (ΔERD, ΔPPI, ΔTPR, ΔTM) to identify regions required for specific functions

    • Create catalytically inactive PPIase mutants that retain structural integrity

    • Use LIR motif mutants to disrupt specific protein interactions while maintaining others

  • Dominant Negative Approaches:

    • Express individual domains (e.g., PPI domain alone) that can competitively inhibit specific interactions

    • Express FKBP8 ΔPPI to disrupt scaffolding while maintaining other functions

  • Rescue Experiments:

    • Perform complementation studies in FKBP8-knockout cells with various mutant constructs

    • Use chimeric proteins where FKBP8 domains are replaced with equivalent domains from related proteins

  • Temporal Control:

    • Employ inducible expression or degradation systems to observe acute effects

    • Use optogenetic approaches to control FKBP8 localization or interactions with temporal precision

  • Direct vs. Indirect Binding Partners:

    • Use in vitro binding assays with purified components to identify direct interactions

    • Employ cross-linking approaches followed by mass spectrometry to identify interaction networks

    • Perform sequential immunoprecipitation to identify multiprotein complexes

These approaches, used in combination, can help dissect the multifunctional nature of FKBP8 and distinguish between its enzymatic activities and its role as a molecular scaffold in various cellular contexts.

What are the most promising therapeutic applications for modulating FKBP8 activity?

Based on current research, several therapeutic applications for FKBP8 modulation show promise:

  • Inflammatory Bowel Disease: FKBP8 inhibition could serve as a non-immunosuppressive approach to restore intestinal barrier function in conditions like Crohn's disease . Monofunctional FKBP inhibitors specifically targeting FKBP8 might be effective barrier-restorative agents without causing immunosuppression .

  • Cardiovascular Protection: Enhancing FKBP8 activity could protect cardiomyocytes from stress-induced apoptosis, potentially beneficial in conditions like pressure overload, ischemia-reperfusion injury, or heart failure . FKBP8 prevents ER stress-induced apoptosis and caspase-12 activation in cardiomyocytes.

  • Neurodegenerative Disorders: Given FKBP8's role in mitophagy and protein folding, modulating its activity might help clear damaged mitochondria and misfolded proteins in conditions like Parkinson's disease and Alzheimer's disease .

  • Cancer Therapy: FKBP8's anti-apoptotic function through Bcl-2/Bcl-XL interactions suggests that inhibiting these specific interactions might sensitize cancer cells to apoptosis-inducing therapies .

To advance these potential applications, researchers should focus on:

  • Developing highly specific FKBP8 modulators

  • Conducting preclinical studies in relevant disease models

  • Investigating tissue-specific effects of FKBP8 modulation

  • Understanding potential side effects based on FKBP8's multiple functions

What are the emerging technologies that could advance our understanding of FKBP8 biology?

Several cutting-edge technologies hold promise for advancing FKBP8 research:

  • CRISPR-Based Technologies:

    • CRISPR activation/inhibition systems for endogenous FKBP8 modulation

    • CRISPR-mediated tagging of endogenous FKBP8 for live-cell imaging

    • Base editing for introducing specific mutations in FKBP8

  • Advanced Imaging Technologies:

    • Super-resolution microscopy to visualize FKBP8 dynamics at mitochondria-ER contact sites

    • Live-cell mitophagy imaging with improved temporal resolution

    • Correlative light and electron microscopy (CLEM) for ultrastructural analysis

  • Proteomics and Interactomics:

    • Proximity labeling approaches (BioID, APEX) to identify context-specific FKBP8 interactors

    • Thermal proteome profiling to identify FKBP8 modulators

    • Crosslinking mass spectrometry to map interaction interfaces

  • Structural Biology Advances:

    • Cryo-electron microscopy of FKBP8 complexes

    • AlphaFold2 and other AI-based structure prediction for complex modeling

    • Nuclear magnetic resonance studies of FKBP8 dynamic interactions

  • Single-Cell Technologies:

    • Single-cell proteomics to analyze FKBP8 expression and modifications across cell populations

    • Spatial transcriptomics to understand FKBP8 expression patterns in tissues

    • Multiomics approaches integrating transcriptomic, proteomic, and metabolomic data

  • In Silico Drug Design:

    • Structure-based virtual screening for FKBP8-specific modulators

    • Machine learning approaches to predict FKBP8-ligand interactions

    • Molecular dynamics simulations of FKBP8 conformational changes

These emerging technologies, combined with traditional biochemical and cell biological approaches, will provide deeper insights into FKBP8's multifaceted roles in cellular homeostasis and disease pathogenesis, ultimately facilitating the development of targeted therapeutic strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.