Recombinant Mouse Peroxisomal biogenesis factor 3 (Pex3)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mouse Peroxisomal Biogenesis Factor 3 (Pex3)

Recombinant Mouse Peroxisomal Biogenesis Factor 3 (Pex3) is a protein crucial for the creation and upkeep of peroxisomes, which are vital organelles involved in various metabolic processes within cells . Peroxisomes participate in the metabolism of reactive oxygen species (ROS) and lipids . Pex3 is essential for assembling membrane vesicles before matrix proteins are moved into the peroxisome .

Role in Peroxisome Biogenesis

Pex3 is an integral peroxisomal membrane protein that plays a vital role in the early stages of peroxisome biogenesis and the assembly of the machinery responsible for importing matrix proteins . Pex3 facilitates the docking of Pex19, a peroxin that acts as a receptor or chaperone for peroxisomal membrane proteins (PMPs) . Cells lacking Pex3 do not have mature peroxisomes or any peroxisomal remnants . Studies in Saccharomyces cerevisiae have shown that Pex3 targets specific locations in the endoplasmic reticulum (ER), creating a dynamic ER subcompartment that leads to peroxisome formation .

Pex3 and Peroxisome Inheritance

Pex3 not only plays a role in peroxisome formation but also in peroxisome inheritance . Pex3 proteins function as peroxisomal receptors for class V myosin, which transports peroxisomes along actin filaments to daughter cells . In cells lacking Pex3, peroxisomes are retained by the mother cell. Overexpression of Pex3 causes peroxisomes to gather and transfer en masse to daughter cells .

Impact of Pex3 Deficiency

Deficiency in Pex3 can lead to disrupted peroxisome function and various related issues . Studies on Pex3-knockout (KO) mice have revealed that Pex3 deficiency disrupts peroxisome function, leading to increased ROS accumulation in the myocardium . This can cause the cessation of cardiomyocyte cell cycle progression and loss of cardiac regenerative capacity .

Observed Effects of Pex3 Deficiency in Mice :

  • Abnormal number and morphology of peroxisomes.

  • Increased DHE fluorescence intensity, indicating heightened ROS levels.

  • Significant increase in Malondialdehyde (MDA) levels, a marker of lipid peroxidation.

  • Elevated expression level of γH2X, a marker of DNA damage.

Pex3 in Different Tissues and Cell Types

The abundance of Pex3 varies significantly across different organs and cell types in the mouse, suggesting that peroxisome abundance, biogenesis, and matrix protein import are independently regulated .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify it in your order; we will prioritize fulfilling your request.
Synonyms
Pex3; Peroxisomal biogenesis factor 3; Peroxin-3; Peroxisomal assembly protein PEX3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-372
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Pex3
Target Protein Sequence
MLRSMWNFLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAAEYIAQARRQYHFES NQRTCNMTVLSMLPTLREALMQQLNSESLTALLKSRPSNKLEIWEDLKIISFTRSIVAVY STCMLVVLLRVQLNIIGGYIYLDNATVGKNGTTVLAPPDVQQQYLSSIQHLLGDGLTELV TVIKQAVQRILGSVSLKHSLSLLDLEQKLKEIRILVEQHQSSWNDKDVSRSSLCQYMMPD EETPLAAQAYGLSHRDITTIKLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFRP TEQDLQHGNSINSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLMMEQVKDFAANV YEAFSTPQQLEK
Uniprot No.

Target Background

Function

Peroxisomal biogenesis factor 3 (PEX3) plays a crucial role in peroxisome biosynthesis and maintenance. It facilitates the assembly of peroxisomal membrane vesicles prior to matrix protein translocation. Functioning as a docking factor for PEX19, PEX3 is essential for the import of peroxisomal membrane proteins into peroxisomes.

Database Links
Protein Families
Peroxin-3 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.
Tissue Specificity
Identified in all tissues analyzed, with the strongest expression in liver and in testis.

Q&A

What is the primary function of Pex3 in peroxisome biogenesis?

Pex3 serves as a critical peroxisomal membrane protein (PMP) essential for peroxisome biogenesis across eukaryotes. Its primary function involves docking Pex19, which acts as a receptor and/or chaperone for PMPs. This interaction is fundamental to peroxisome formation, as cells lacking either Pex3 or Pex19 are completely devoid of mature peroxisomes and even peroxisomal remnants .

Mechanistically, Pex3 initially targets to discrete endoplasmic reticulum (ER)-localized punctae, forming a dynamic ER subcompartment that serves as the site of de novo peroxisome biogenesis. This pathway was conclusively demonstrated in Saccharomyces cerevisiae and has been confirmed in various organisms, including mice . Beyond its role in biogenesis, Pex3 also contributes to peroxisome inheritance during cell division by linking peroxisomes to cytoskeletal elements.

What phenotypes are observed in Pex3-knockout mice?

Pex3-knockout mice exhibit severe developmental abnormalities, particularly affecting reproductive function in males. Specifically, Pex3-KO male mice display:

  • Abnormal testicular development and reduced testicular volumes

  • Completely absent sperm in the epididymis, indicating complete spermatogenesis blockade

  • Formation of unique pathological structures called syncytia in the testicular lumen

  • Complete infertility

  • Abnormal testicular lumen structure as revealed by histological examination

These findings demonstrate that Pex3 is essential not only for peroxisome biogenesis but also for normal spermatogenesis and male fertility in mice, highlighting the critical role of peroxisomes in reproductive development.

What protein interactions does Pex3 form to execute its functions?

Pex3 engages in multiple protein interactions that facilitate its diverse functions:

Interaction PartnerBinding MotifFunctional Significance
Pex19LXXLL ("leucine triad")Essential for peroxisome biogenesis; serves as docking site for Pex19-PMP complexes
Inp1 (in yeast)Similar to Pex19's LXXLL motifFacilitates peroxisome tethering to the plasma membrane
Atg30 (in P. pastoris)L320/N325 regionRegulates pexophagy through receptor activation
Class V myosin (in yeast)Not specified in sourcesDirects peroxisomes into daughter cells during cell division

The interaction between Pex3 and Pex19 is particularly well-characterized. Mutation studies have identified critical residues in both proteins that mediate this interaction. For example, in Trypanosoma brucei, TbPex3-F102A and TbPex3-L105A mutations abolish interaction with TbPex19, similar to how ScPex3-W128A and ScPex3-L131A mutations prevent interaction with ScPex19 in yeast .

What are the optimal experimental approaches for studying Pex3-protein interactions?

Researchers can employ several complementary techniques to study Pex3-protein interactions:

  • Yeast Two-Hybrid Analysis: This approach has successfully identified interactions between Pex3 and partners like Pex19 and Atg30. When using this method, include appropriate controls such as testing Pex3 self-interaction (typically negative) alongside positive interaction pairs .

  • Co-Immunoprecipitation: For validating interactions in vivo, co-IP can be performed under native conditions. When studying transient interactions involved in degradation pathways (like pexophagy), use strains defective in downstream processes to accumulate complexes. For example, researchers studying Pex3-Atg30 interaction in P. pastoris used Δypt7 strains defective in autophagosome-vacuole fusion to accumulate complexes on cytosolic pexophagosomes .

  • Mutational Analysis: Site-directed mutagenesis targeting conserved residues can identify critical interaction domains. For example, mutation of leucine residues in the LXXLL motif significantly reduces Pex3-Pex19 binding affinity . When designing mutations, refer to structural data or homology models to target surface-exposed residues in predicted interaction interfaces.

  • Structural Approaches: For detailed mechanistic insights, crystal structures (like that of human PEX3) can inform hypothetical models of mouse Pex3 to predict interaction domains .

How can Pex3 mutations be designed to study specific functions without disrupting peroxisome biogenesis?

Strategic mutation design is critical for separating Pex3's multiple functions. Research in yeast models provides valuable guidance:

What are the methodological considerations for generating and analyzing Pex3-knockout mice?

When working with Pex3-knockout mice, researchers should consider:

  • Verification Strategy: Confirm successful gene deletion through:

    • Genomic PCR

    • Western blot analysis for protein expression

    • Functional peroxisome assays

  • Reproductive Function Assessment:

    • Testicular development (volume, weight, organ ratios)

    • Histological examination (H&E staining)

    • Epididymal sperm analysis

    • Fertility testing

  • Analysis of Peroxisome-Dependent Processes: Beyond reproductive phenotypes, examine:

    • Metabolism of very long-chain fatty acids

    • Bile acid synthesis

    • ROS metabolism

    • Organelle cooperation (particularly with mitochondria)

  • Tissue-Specific Effects: Due to the diverse functions of peroxisomes across tissues, comprehensive phenotyping should include:

    • Liver function (primary site of peroxisome abundance)

    • Brain development (particularly relevant for Zellweger spectrum disorders)

    • Metabolic parameters

How can researchers study Pex3-mediated pexophagy in mammalian systems?

While much of our understanding of Pex3's role in pexophagy comes from yeast studies, translating these findings to mammalian systems requires specific approaches:

  • Receptor Identification: The mammalian functional equivalent of yeast Atg30 must be identified. Current evidence suggests that mammalian NBR1 and p62 may serve as pexophagy receptors, but their potential interaction with Pex3 requires investigation .

  • Experimental Design for Pexophagy Induction:

    • Nutrient starvation conditions

    • Treatment with ROS-inducing agents

    • Expression of peroxisome proliferator-activated receptor (PPAR) agonists followed by withdrawal

  • Monitoring Methods:

    • Fluorescent protein-tagged peroxisomal markers

    • Immunoblotting for peroxisomal proteins

    • Electron microscopy to visualize peroxisome sequestration by autophagosomes

    • Live-cell imaging to track peroxisome dynamics

  • Key Controls:

    • General autophagy inhibitors (e.g., 3-methyladenine)

    • ATG gene knockdowns to distinguish pexophagy from general autophagy

    • Comparison with known pexophagy-inducing conditions

What are the current contradictions in research regarding Pex3 function?

Several aspects of Pex3 function remain subjects of ongoing investigation and debate:

  • Origin of Peroxisomes: While strong evidence suggests that the ER is the site of de novo peroxisome biogenesis involving Pex3, some studies indicate that peroxisome number can be maintained in wild-type cells through alternative mechanisms .

  • Species-Specific Functions: There are notable differences in how Pex3 functions across species:

    • In T. brucei, TbPex3 exhibits less stringency in its binding requirements for Pex19 compared to yeast ScPex3

    • The pexophagy role of Pex3 is well-established in yeast but remains to be fully characterized in mammals

  • Dual Role in Biogenesis and Degradation: Pex3 appears to have seemingly contradictory functions:

    • Essential for peroxisome formation

    • Also involved in peroxisome degradation (pexophagy) in some organisms

    • How these opposing functions are regulated remains unclear

What technical challenges affect recombinant mouse Pex3 production?

Researchers working with recombinant mouse Pex3 face several technical challenges:

  • Membrane Protein Expression: As an integral membrane protein, Pex3 presents typical challenges for recombinant expression:

    • Potential toxicity to expression hosts

    • Proper folding and membrane integration

    • Solubility issues during purification

  • Functional Validation: Confirming that recombinant Pex3 retains native activity requires:

    • Binding assays with known partners (especially Pex19)

    • Structural analysis to confirm proper folding

    • Activity in complementation assays

  • Expression Strategies: Based on approaches used for similar proteins:

    • Consider expressing only the cytosolic domain for interaction studies

    • Use appropriate detergents for membrane protein solubilization

    • Test multiple expression systems (bacterial, insect, mammalian)

    • Add solubility tags that can be later removed by specific proteases

How might Pex3 function in non-canonical peroxisome-related processes?

Beyond its established roles, emerging research suggests Pex3 may function in:

  • Signaling Pathways: In P. pastoris, Pex3 affects the phosphorylation status of the pexophagy receptor Atg30, suggesting a role beyond simple protein docking and potentially involving signal transduction .

  • Organelle Contacts: Pex3 may mediate contacts between peroxisomes and other organelles, particularly the ER from which peroxisomes originate.

  • Stress Responses: Given its role in pexophagy, Pex3 may function in cellular stress response mechanisms, potentially linking peroxisome function to cellular adaptation.

  • Developmental Regulation: The severe reproductive phenotypes in Pex3-KO mice suggest potential roles in developmental signaling that extend beyond basic peroxisome biogenesis .

What therapeutic implications arise from understanding mouse Pex3 function?

Research on mouse Pex3 has potential translational implications:

  • Peroxisomal Disorders: Understanding Pex3 function may inform therapeutic approaches for Zellweger Spectrum Disorders caused by PEX gene mutations.

  • Male Infertility: The complete infertility in Pex3-KO mice suggests that Pex3 dysfunction could contribute to certain forms of human male infertility, potentially offering diagnostic or therapeutic targets .

  • Metabolic Diseases: Given peroxisomes' roles in lipid metabolism, insights from Pex3 research may inform approaches to metabolic disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.