Recombinant Mouse Peroxisomal membrane protein PEX16 (Pex16)

Shipped with Ice Packs
In Stock

Description

Introduction

Peroxisomal membrane protein PEX16 is a protein crucial for peroxisome biogenesis in mammalian cells . Encoded by the PEX16 gene, PEX16 is an integral membrane protein found in both the endoplasmic reticulum (ER) and peroxisomes . It features two transmembrane domains, with both the N- and C-termini facing the cytosol .

Function

PEX16 plays a vital role in the de novo synthesis of peroxisomes, particularly in the early stages within the ER . It facilitates the integration of the peroxin PEX3 into the ER membrane, which is essential for the subsequent insertion of other PEX3-dependent peroxisomal membrane proteins (PMPs) . PEX16 acts as a receptor for PEX3, mediating the integration and assembly of PMPs into membranes .

PEX16 in Different Organisms

PEX16 homologs exhibit variations in structure and function across different species .

  • Yarrowia lipolytica (YlPex16p): YlPex16p binds to the membrane lipid lyso-phosphatidic acid (LPA) and regulates peroxisome division. It inhibits the fission of peroxisomal subcompartments by suppressing the synthesis of diacylglycerol (DAG) .

  • Humans (HsPEX16): Unlike YlPex16p, human PEX16 contains at least two transmembrane domains, with both the N and C termini facing the cytosol. It functions as a PMP receptor during the early stages of de novo peroxisome formation at the ER and in mature peroxisomes .

  • Arabidopsis thaliana (AtPEX16): AtPEX16 localizes to mature peroxisomes and potentially pre-peroxisomes, acting as a receptor for PEX3 and other group II PMPs. Its trafficking from the ER to peroxisomes involves an ER-peroxisome-intermediate-compartment (ERPIC) .

Role in Peroxisome Biogenesis Disorders

Defects in PEX16 can lead to peroxisome biogenesis disorders (PBDs), including Zellweger syndrome . These disorders are characterized by the toxic accumulation of very long-chain fatty acids (VLC-FAs), very long-chain polyunsaturated fatty acids (VLC-PUFAs), and branched-chain fatty acids, resulting in severe developmental and neurological dysfunctions . Inactivating mutations in the PEX16 gene have been observed in patients with Zellweger syndrome, highlighting its importance in peroxisome organization and biogenesis .

PEX16 and ER-to-Peroxisome Trafficking

The trafficking of PEX16 from the ER to peroxisomes relies on specific molecular targeting signals . In Arabidopsis thaliana, this trafficking involves an ER-peroxisome-intermediate-compartment (ERPIC), comprising ER-derived pre-peroxisomes that coalesce before fusing with mature peroxisomes .

Impact of PEX16 Overexpression and Deficiency

  • Overexpression: Overexpression of PEX16 in wild-type cells can disrupt peroxisome biogenesis, leading to a complete loss of peroxisomes or the formation of fewer, larger peroxisomes .

  • Deficiency: PEX16 deficiency impairs peroxisome biogenesis, which can be rescued by low-level expression of PEX16 .

Functional Domains and Mutants

  • PEX16ΔN69: Lacking the N-terminal 69 amino acid residues, this mutant can localize to peroxisomes and rescue aberrant peroxisomal morphology in PEX16-KO cells but is less efficient in de novo peroxisome formation .

  • PEX16R176X: Identified in a patient with Zellweger syndrome, this mutant fails to accelerate de novo peroxisome formation and can inhibit the generation of PMP70-containing structures .

PEX16 and Lipid Homeostasis

Knockdown of PEX16 leads to a significant reduction in total cholesterol and plasmalogen levels, indicating its role in lipid homeostasis .

PEX16 as a "Master" Peroxin

Human PEX16 (HsPEX16) is inserted into the ER via the SEC61 co-translational import pathway, and PEX3 is only found at the ER in the presence of HsPEX16 . This suggests that HsPEX16 acts as the "master" peroxin responsible for initiating peroxisome biogenesis at the ER in mammals .

Interactions

PEX16 has been shown to interact with PEX19, a cytosolic receptor/chaperone that delivers PMPs to the membrane-bound docking receptor PEX3 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Pex16; Peroxisomal membrane protein PEX16; Peroxin-16; Peroxisomal biogenesis factor 16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-336
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Pex16
Target Protein Sequence
MEKLRLLSLRYQEYVTRHPAATAQLETAVRGLSYLLAGRFSDSHELSELVYSASNLLVLL NDGILRKELRKKLPVSLSQQKLLTWLSVLECVEVFMEMGAAKVWGEVGRWLVIALIQLAK AVLRMLLLIWFKAGIQTSPPIVPLDRETQAQPLDGDHNPGSQEPSYVGKRSHRVVRTLQN SPSLHSRYWGAPQQREIRQKQQQEELSTPPTPLGLQETIAESLYIARPLLHLLSLGLWGQ RSWTPWLLSGVVDMTSLSLLSDRKNLTRRERLELRRRTILLLYYLLRSPFYDRFSEAKIL FLLQLLTDHIPGVGLVARPLMDYLPSWQKIYFYSWG
Uniprot No.

Target Background

Function

Recombinant Mouse Peroxisomal membrane protein PEX16 (Pex16) is required for peroxisome membrane biogenesis and may play a crucial role in the early stages of peroxisome assembly. It facilitates the recruitment of other peroxisomal proteins, such as PEX3 and PMP34, to de novo peroxisomes derived from the endoplasmic reticulum (ER). PEX16 may also function as a receptor for PEX3.

Database Links
Protein Families
Peroxin-16 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.

Q&A

What is mouse PEX16 and what is its primary function in peroxisome biology?

PEX16 is an integral peroxisomal membrane protein essential for peroxisome biogenesis. In mice, PEX16 is approximately 39 kDa (calculated molecular weight 38.7 kDa) and functions primarily in the organization and assembly of peroxisomes . PEX16 plays a critical role in peroxisomal membrane protein (PMP) insertion and recruitment, particularly in the early stages of peroxisome assembly . The mouse protein contains 336 amino acids and functions as part of the peroxisome biogenesis pathway alongside other peroxins, including PEX3 and PEX19 .

Functionally, mouse PEX16 exhibits:

  • Protein binding activity, particularly protein C-terminus binding

  • Direct interactions with PEX19, PEX3, and PEX14 as key binding partners

  • Involvement in the Peroxisome pathway alongside proteins such as ACOX3, AGPS, MVK, HMGCL, and PEX26

What are the best expression systems for producing functional recombinant mouse PEX16?

Several expression systems have proven effective for producing recombinant mouse PEX16, each with specific advantages:

Expression SystemTag OptionsAdvantagesApplications
HEK-293 CellsHis, Myc, DDK, FcHigh post-translational modification fidelity, good foldingProtein interaction studies, functional assays
E. coliHis, Non-taggedHigh yield, economicalAntibody production, structural studies
Cell-free systemsStrep TagAvoids transmembrane protein toxicity issues, rapid productionReconstitution experiments
Mammalian cellsVariousNative-like processingAdvanced functional studies

Methodology recommendation: For most functional studies examining mouse PEX16 in peroxisome biogenesis, mammalian expression systems (particularly HEK-293) are preferred as they provide proper post-translational modifications and membrane insertion. For proteins used in antibody production or basic binding studies, E. coli systems may be sufficient .

How can researchers verify the functional activity of recombinant mouse PEX16?

Functional verification of recombinant mouse PEX16 can be performed through several complementary approaches:

  • Rescue experiments in PEX16-deficient cells: Transfection of recombinant PEX16 into pex16 mutant cells should restore peroxisome formation. Researchers have shown that expression of PEX16 "morphologically and biochemically restores the formation of new peroxisomes" .

  • Subcellular localization studies: Functional PEX16 should localize to both the ER and peroxisomal membranes. This can be verified using:

    • Immunofluorescence with anti-PEX16 antibodies

    • Co-localization with known ER and peroxisomal markers

    • Subcellular fractionation followed by Western blotting

  • Interaction partner verification: Functional PEX16 should demonstrate binding to known partners:

    • Co-immunoprecipitation with PEX3, PEX19, and PEX14

    • Yeast two-hybrid or pull-down assays to confirm protein-protein interactions

  • Peroxisome proliferation assays: In cells with functional PEX16, peroxisome number and size should respond appropriately to proliferation stimuli .

How do mouse and human PEX16 differ in structure and function, and what implications does this have for research models?

While mouse and human PEX16 share considerable homology and similar functions, important differences exist that researchers should consider when designing experiments:

FeatureMouse PEX16Human PEX16Research Implications
Size336 amino acids, 38.7 kDa336 amino acids, 39 kDaSimilar size facilitates comparative studies
Membrane topologyTwo transmembrane domainsTwo transmembrane domainsSimilar membrane insertion mechanisms
Subcellular targetingBoth ER and peroxisomesBoth ER and peroxisomesMouse models likely reflect human trafficking pathways
Species-specific interactionsExhibits some mouse-specific protein-protein interactionsSome human-specific binding partnersCross-species rescue experiments may show partial complementation
Disease model relevanceMouse pex16 mutants show peroxisome defectsHuman PEX16 mutations cause Zellweger syndromeMouse models valuable for human disease research but with some limitations

When using mouse PEX16 as a model for human peroxisome disorders, researchers should note that while the fundamental functions are conserved, there may be species-specific differences in regulation and interaction networks. Cross-species complementation studies have shown that human PEX16 can partially rescue peroxisome formation in other model systems, suggesting conserved core functions .

What methods are most effective for studying PEX16's role in peroxisome biogenesis?

Several methodological approaches have proven valuable for investigating PEX16's functions:

  • Gene silencing and knockout models:

    • siRNA or shRNA-mediated silencing of Pex16 in 3T3-L1 cells has revealed its importance in adipocyte development and lipid metabolism

    • CRISPR/Cas9-mediated knockout in mammalian cells

    • Drosophila models with Pex16KZ alleles that can be "humanized" by expressing human PEX16

  • Live-cell imaging techniques:

    • Tracking peroxisome formation in real-time following re-introduction of PEX16

    • Fluorescent protein tagging to monitor PEX16 trafficking between ER and peroxisomes

  • Biochemical fractionation and proteomics:

    • Density gradient fractionation to isolate peroxisomes

    • Mass spectrometry to identify PEX16 interaction partners

    • Proximity labeling techniques to identify transient interactions

  • Electron microscopy:

    • Immunogold labeling to precisely localize PEX16 within peroxisomal and ER membranes

    • Visualization of peroxisome morphology changes in PEX16-deficient cells

  • Functional metabolic assays:

    • Measurement of peroxisomal fatty acid oxidation

    • Analysis of long- and very-long-chain fatty acid accumulation

    • Cellular oxygen consumption measurement

What is known about how mutations in mouse PEX16 affect peroxisome function, and how can these be experimentally assessed?

Mutations in mouse PEX16 have significant effects on peroxisome function and cellular metabolism. Recent studies have documented several approaches to assess these changes:

  • Characterization of pex16 alleles:

    • Viable Arabidopsis pex16 alleles accumulate negligible PEX16 protein and display impaired peroxisome function, including slowed consumption of stored oil bodies, decreased import of matrix proteins, and increased peroxisome size

    • Drosophila pex16 null alleles show bang sensitivity (seizure-like behavior) and climbing defects, which can be partially rescued by human PEX16 expression

  • Assessment methodologies:

    • Matrix protein import: Immunofluorescence for peroxisomal matrix proteins (such as PEX3) shows reduced punctate staining in pex16 mutant cells

    • Metabolic profiling: Gas chromatography-mass spectrometry analysis reveals accumulation of very long-chain and polyunsaturated fatty acids in PEX16-deficient cells

    • Peroxisome morphology: Electron microscopy shows enlarged peroxisomes in cells overexpressing PEX16, suggesting a role in peroxisome size regulation

    • Genetic complementation assays: Introduction of wild-type PEX16 constructs (PEX16p:PEX16) can accelerate matrix protein degradation in pex16 mutants, confirming the causative role of the mutations

  • Molecular consequences:

    • PEX16 deficiency causes reduced peroxisomal fatty acid oxidation

    • Cellular oxygen consumption decreases in PEX16-silenced cells

    • Adipogenesis and lipogenic marker gene expression are impaired

How is recombinant mouse PEX16 used to study peroxisomal biogenesis disorders?

Recombinant mouse PEX16 serves as a valuable tool for studying peroxisomal biogenesis disorders (PBDs) through several approaches:

  • Disease-causing mutation modeling:

    • Introduction of mutations corresponding to human disease-causing variants into mouse PEX16

    • Humanized fly models expressing wild-type or variant human PEX16 in Drosophila pex16 mutants allow assessment of variant severity

  • Cellular phenotype analysis:

    • Comparing the ability of wild-type versus mutant PEX16 to rescue peroxisome formation

    • Assessing biochemical abnormalities associated with PEX16 dysfunction, such as accumulation of very long-chain fatty acids

  • Functional rescue experiments:

    • Recent studies show that human PEX16 reference genes can partially rescue behavioral defects in Drosophila pex16 mutants, while disease-causing variants often fail to do so

    • These models distinguish between severe loss-of-function variants like PEX16R176* and milder hypomorphic variants

Recent work with Drosophila models has been particularly valuable, as researchers can generate "humanized" flies for PEX16 in which disease-causing variants can be tested for their effects on lifespan, seizure susceptibility, and climbing ability .

What techniques are recommended for studying PEX16 interactions with other peroxins?

Studying the interactions between PEX16 and other peroxins requires specialized techniques due to the membrane-bound nature of these proteins:

  • Co-immunoprecipitation (Co-IP):

    • Effective for capturing stable interactions

    • Requires careful optimization of detergent conditions to solubilize membrane proteins without disrupting interactions

    • Can be combined with mass spectrometry for unbiased interaction mapping

  • Bimolecular fluorescence complementation (BiFC):

    • Allows visualization of protein-protein interactions in living cells

    • Particularly useful for studying the spatial aspects of PEX16 interactions with PEX3 and PEX19

  • Proximity labeling approaches:

    • BioID or APEX2 fusions to PEX16 can identify proteins in close proximity

    • Particularly valuable for capturing transient or weak interactions in the native cellular environment

  • Yeast two-hybrid system modifications:

    • Membrane yeast two-hybrid systems adapted for membrane proteins

    • Split-ubiquitin systems allow detection of membrane protein interactions

Known interaction partners of mouse PEX16 include PEX19, PEX3, and PEX14 , with interactions occurring in both the ER and peroxisomal membranes.

What are the emerging roles of PEX16 beyond peroxisome biogenesis?

Recent research has revealed additional functions of PEX16 beyond its canonical role in peroxisome biogenesis:

  • Adipocyte development and function:

    • PEX16 is highly expressed in adipose tissues and upregulated during adipogenesis

    • It is a target gene of PPARγ, the "master-regulator" of adipogenesis

    • Stable silencing of Pex16 in 3T3-L1 cells impairs adipocyte differentiation and reduces cellular triglyceride stores

  • Lipid metabolism regulation:

    • PEX16 deficiency leads to:

      • Accumulation of long- and very long-chain (polyunsaturated) fatty acids

      • Reduction of odd-chain fatty acids

      • Decreased cellular oxygen consumption

      • Increased fatty acid release

  • Potential roles in cellular signaling:

    • Emerging evidence suggests PEX16 may influence cellular signaling pathways through its effects on lipid metabolism

    • PEX16-silenced cells show reduced responsiveness to PPARγ agonists, suggesting a role in modulating nuclear receptor signaling

What are the current technical challenges in working with recombinant mouse PEX16 and how can they be addressed?

Researchers face several challenges when working with recombinant mouse PEX16:

ChallengeTechnical SolutionMethodological Recommendation
Membrane protein solubilityOptimization of detergent conditionsUse mild detergents like digitonin or DDM; consider nanodiscs or amphipols for maintaining native conformation
Proper folding and insertionSelection of appropriate expression systemPrefer mammalian expression systems (HEK-293) over bacterial systems for functional studies
Verification of functionalityDevelopment of robust functional assaysCombine multiple approaches: localization studies, interaction partner verification, and rescue experiments
Species-specific differencesCross-species complementation studiesUse "humanized" model systems to directly compare mouse and human PEX16 function
Low expression levelsCodon optimization and expression enhancementUse strong promoters and optimize codons for the expression system; consider inducible expression systems

Researchers have successfully addressed many of these challenges by:

  • Using cell-free protein synthesis for problematic constructs

  • Employing Strep-tagged constructs for efficient purification under native conditions

  • Validating protein functionality through complementation of pex16 mutant cell lines

How can multi-omics approaches advance our understanding of PEX16 function?

Integrating multiple omics technologies can provide comprehensive insights into PEX16 function:

  • Proteomics approaches:

    • Quantitative proteomics to identify changes in the peroxisomal proteome upon PEX16 manipulation

    • Interactomics to map the complete PEX16 interaction network

    • Post-translational modification analysis to understand regulatory mechanisms

  • Lipidomics applications:

    • Comprehensive analysis of lipid species affected by PEX16 deficiency

    • Correlation of peroxisomal lipid metabolism changes with cellular phenotypes

    • Identification of specific lipid biomarkers of peroxisome dysfunction

  • Transcriptomics integration:

    • RNA-seq analysis to identify genes regulated downstream of PEX16

    • Investigation of the relationship between PEX16 and PPARγ-mediated transcriptional networks in adipocytes

  • Systems biology approaches:

    • Integration of multi-omics data to build comprehensive models of peroxisome biogenesis

    • Network analysis to position PEX16 within cellular metabolic and signaling pathways

    • Computational modeling of the temporal dynamics of peroxisome formation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.