Recombinant Mouse Peroxisomal membrane protein PMP34 (Slc25a17)

Shipped with Ice Packs
In Stock

Description

Introduction to PMP34 and Slc25a17

Recombinant Mouse Peroxisomal membrane protein PMP34 (Slc25a17) is a synthetic variant of the endogenous PMP34 protein, encoded by the Slc25a17 gene. This protein is a peroxisomal membrane transporter belonging to the mitochondrial solute carrier family (SLC25A17) and plays critical roles in peroxisomal cofactor transport and lipid metabolism .

Production and Biochemical Characteristics

The recombinant PMP34 protein is synthesized in mammalian cells (e.g., CSB-MP021484MO1) or yeast (e.g., CSB-YP021484MO1) . Key production details include:

AttributeMammalian Cell Version (CSB-MP021484MO1)Yeast Version (CSB-YP021484MO1)
Purity>85% (SDS-PAGE)>85% (SDS-PAGE)
TagUndisclosed (determined during production)Undisclosed
Storage-20°C/-80°C (6–12 months shelf life)-20°C/-80°C (6–12 months shelf life)

This recombinant protein retains functional domains critical for its role as a counter-exchanger of cofactors (e.g., CoA, FAD, FMN, AMP) and nucleotides (e.g., NAD⁺, ADP) .

Research Findings from Mouse Models

Studies using PMP34-deficient (Slc25a17 knockout) mice revealed its role in lipid metabolism and peroxisomal function:

Phenotype/ParameterObservationSource
Baseline PhenotypeNo obvious abnormalities on Swiss Webster background
Phytol-Induced ResponseHepatomegaly, liver inflammation, elevated hepatic triglycerides/cholesteryl esters
Phytanic/Pristanic Acid AccumulationIncreased levels in liver lipids (higher in females)
Peroxisomal CofactorsNormal CoA, ATP, NAD⁺, FAD levels under standard conditions
Bile Acid PathwayNo abnormal intermediates detected

PMP34 deficiency disrupts branched-chain fatty acid degradation, particularly during phytol metabolism, leading to accumulation of phytanic/pristanic acids and their CoA-esters .

Functional Role in Cellular Processes

PMP34 facilitates bidirectional transport of peroxisomal cofactors via a counter-exchange mechanism:

  • Inward Transport: CoA, FAD, FMN, NAD⁺

  • Outward Transport: AMP, ADP (to lesser extent) .

This activity is essential for:

  1. Peroxisomal β-oxidation: Providing CoA for acyl-CoA formation during lipid degradation .

  2. Antiviral Signaling: Indirectly linked to peroxisome-mediated innate immune responses (e.g., RIG-I/MAVS pathways) .

Applications and Experimental Uses

The recombinant PMP34 protein is utilized in:

ApplicationPurposeSource
Peroxisomal Transport StudiesAnalyzing cofactor exchange mechanisms
Lipid Metabolism ResearchInvestigating phytanic/pristanic acid degradation pathways
Viral Pathogenesis ModelsExploring peroxisome-virus interactions (e.g., HPV entry mechanisms)
Diagnostic AssaysValidating PMP34-specific antibodies or inhibitors

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a reference for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Slc25a17; Pmp34; Pmp35; Peroxisomal membrane protein PMP34; 34 kDa peroxisomal membrane protein; Solute carrier family 25 member 17
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Slc25a17
Target Protein Sequence
MASVLSYESLVHAVAGAVGSVTAMTVFFPLDTARLRLQVDEKRKSKTTHAVLLEIIKEEG LLAPYRGWFPVISSLCCSNFVYFYTFNSLKAVWVKGQRSSTGKDLVVGFVAGVVNVLLTT PLWVVNTRLKLQGAKFRNEDIIPTNYKGIIDAFHQIIRDEGILALWNGTFPSLLLVFNPA IQFMFYEGLKRQLLKKRMKLSSLDVFIIGAIAKAIATTVTYPMQTVQSILRFGRHRLNPE NRTLGSLRNVLSLLHQRVKRFGIMGLYKGLEAKLLQTVLTAALMFLVYEKLTAATFTVMG LKSTHKH
Uniprot No.

Target Background

Function
PMP34 (SLC25A17) is a peroxisomal transporter for various cofactors, including coenzyme A (CoA), flavin adenine dinucleotide (FAD), flavin mononucleotide (FMN), and adenosine monophosphate (AMP). It also transports, to a lesser extent, nicotinamide adenine dinucleotide (NAD+), adenosine diphosphate (ADP), and adenosine 3',5'-diphosphate (PAP). It likely facilitates the counter-exchange transport of free CoA, FAD, and NAD+ from the cytosol into the peroxisomal matrix. In vitro studies demonstrate inhibition by pyridoxal 5'-phosphate and bathophenanthroline.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Cytoplasm. Peroxisome membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in liver.

Q&A

What is the function and characterization of PMP34 in mouse peroxisomes?

PMP34 (encoded by the Slc25a17 gene) is a peroxisomal membrane transporter belonging to the mitochondrial solute carrier family. This protein contains three tandem-repeated modules of approximately 100 amino acids, each consisting of two hydrophobic transmembrane α-helices connected by a large hydrophilic loop. Functionally, PMP34 serves as a transporter for cofactors including Coenzyme A (CoA), flavin adenine dinucleotide (FAD), flavin mononucleotide (FMN), and adenosine monophosphate (AMP), with lesser activity for adenosine diphosphate (ADP) and nicotinamide adenine dinucleotide (NAD+). It operates as a counter-exchanger, likely transporting CoA, FAD, and NAD+ inward while moving AMP outward .

Methodology for characterization:

  • Membrane topology analysis using protease protection assays

  • Transport assays using reconstituted proteoliposomes with radiolabeled substrates

  • Immunofluorescence microscopy to confirm peroxisomal localization

  • Yeast complementation studies to verify functional conservation

What phenotypes are observed in PMP34 knockout mice?

Mice lacking PMP34 (Slc25a17 gene trapped mice) show no obvious phenotype when maintained on a Swiss Webster genetic background under normal conditions. Various treatments designed to unmask impaired peroxisomal functioning also failed to produce notable phenotypes under standard conditions .

  • Hepatomegaly and liver inflammation

  • Induction of peroxisomal enzymes (partially mediated by peroxisome proliferator-activated receptor alpha [PPARα])

  • Elevated hepatic triacylglycerols and cholesteryl esters

  • Accumulation of phytanic acid and pristanic acid in liver lipids (females showing higher accumulation than males)

  • Presence of pristanic acid degradation products and CoA-esters of branched fatty acids

This phenotype difference between normal and challenged conditions suggests PMP34 becomes critical when the peroxisomal system is under metabolic stress.

How can I generate recombinant mouse PMP34 protein for in vitro studies?

Methodology for recombinant PMP34 production:

  • Expression System Selection:

    • Bacterial expression: Use of Escherichia coli systems with specialized tags (maltose-binding protein or glutathione-S-transferase fusion proteins have been successfully used for similar peroxisomal membrane proteins)

    • Eukaryotic expression: Consider insect cell or mammalian cell systems for proper folding and post-translational modifications

  • Construct Design:

    • Include appropriate purification tags (His, GST, or MBP)

    • Consider using truncated constructs excluding transmembrane domains if studying interaction domains

    • Optimize codon usage for the expression system

  • Purification Protocol:

    • Membrane protein extraction using appropriate detergents (n-dodecyl-β-D-maltoside or digitonin)

    • Affinity chromatography based on fusion tag

    • Size exclusion chromatography for final purification

    • Verification of purity by SDS-PAGE and Western blotting

  • Functional Validation:

    • Reconstitution into liposomes to test transport activity

    • Binding assays with known substrates and cofactors

    • Circular dichroism to confirm proper folding

How does PMP34 deficiency affect peroxisomal metabolic pathways?

In PMP34-deficient mice, most peroxisomal metabolic pathways remain remarkably intact under normal conditions:

Peroxisomal PathwayEffect in PMP34 Knockout MiceMethodological Assessment
α-oxidationMinimal impact under normal conditions; compromised under phytol challengeMeasure phytanic acid levels in tissues
β-oxidationMinimal impact under normal conditions; compromised for pristanic acidMeasure pristanic acid and metabolites in tissues
Bile acid synthesisNo abnormal bile acid intermediates detectedBile acid profiling by LC-MS/MS
Plasmalogen biosynthesisNormal tissue plasmalogen levelsLipidomic analysis
Very long chain fatty acid metabolismNormal levelsGas chromatography analysis
Cofactor homeostasisApparently normal based on indirect assessmentMetabolic flux analysis

When challenged with dietary phytol, PMP34 knockout mice accumulate phytanic acid and pristanic acid, suggesting that while PMP34 is not essential for basic peroxisomal fatty acid metabolism under normal conditions, it becomes critical when the system is challenged with branched-chain fatty acids .

Experimental approach to assess these pathways:

  • Metabolomic profiling of tissues from knockout versus wild-type mice

  • Isotope-labeled substrate tracing experiments

  • Primary cell culture from knockout mice for in vitro metabolic analysis

  • Dietary interventions to challenge specific pathways

What is the molecular mechanism of PMP34-mediated transport?

While the search results establish PMP34 as a transporter for CoA, FAD, FMN, and AMP, they don't fully elucidate the molecular mechanism. To investigate this:

  • Transport Kinetics Analysis:

    • Measure substrate Km and Vmax values using purified recombinant protein reconstituted in liposomes

    • Determine transport stoichiometry

    • Assess competitive inhibition patterns between different substrates

  • Structure-Function Relationship:

    • Site-directed mutagenesis of conserved residues in transmembrane helices

    • Construction of chimeric transporters with related family members

    • Homology modeling based on other solute carrier family members

  • Regulatory Mechanisms:

    • Investigation of post-translational modifications affecting transport activity

    • Assessment of pH dependence and electrochemical gradient requirements

    • Identification of interacting proteins that modulate transport

  • Substrate Specificity Profiling:

    • Comprehensive screening of potential substrates and inhibitors

    • Analysis of substrate chemical features determining recognition

Current evidence indicates PMP34 functions as a counter-exchanger rather than a uniporter, which has significant implications for peroxisomal metabolite exchange with the cytosol .

How do sex differences impact phenotypic expression in PMP34-deficient mice?

Female PMP34 knockout mice accumulate phytanic acid and pristanic acid in liver lipids to a higher extent than males when challenged with dietary phytol . This sexual dimorphism suggests several research directions:

  • Hormonal Regulation Analysis:

    • Gonadectomy studies to determine the role of sex hormones

    • Hormone replacement experiments

    • Analysis of sex hormone receptor binding sites in Slc25a17 regulatory regions

  • Sex-specific Compensatory Mechanisms:

    • Transcriptomic comparison of male vs. female knockout mice

    • Proteomic analysis of peroxisomal proteins

    • Metabolomic profiling with attention to sex-specific differences

  • Experimental Design Considerations:

    • Include both sexes in all experiments with separate analysis

    • Control for estrous cycle in females

    • Consider hormonal status in result interpretation

  • Clinical Translation Implications:

    • Consideration of sex differences in any potential human studies

    • Sex-specific biomarker development

What is the relationship between PMP34 and viral infections?

Recent research has identified unexpected connections between peroxisomal proteins and viral pathways:

  • PMP34 and HPV Infection:

    • CRISPR screening identified SLC25A17 (encoding PMP34) as involved in the human papillomavirus (HPV) infection pathway

    • Validation experiments showed that guide RNAs against SLC25A17 attenuated HPV pseudovirion infection in 293FT and HeLa cells

  • Peroxisomes and SARS-CoV-2:

    • SARS-CoV-2 infection causes dramatic restructuring of peroxisomal membranes

    • Viral ORF14 protein physically interacts with peroxisomal membrane protein PEX14

    • This interaction may disrupt peroxisome biogenesis and antiviral signaling

  • Research Approaches:

    • Co-immunoprecipitation of recombinant PMP34 with viral proteins

    • Localization studies during viral infection

    • Viral replication assays in PMP34-depleted versus control cells

    • Investigation of peroxisome-mediated antiviral signaling in PMP34-deficient models

  • Mechanistic Hypotheses:

    • PMP34 may serve as a direct viral receptor or co-receptor

    • Viruses may target PMP34 to disrupt peroxisomal metabolism and immune signaling

    • Alterations in PMP34-dependent peroxisomal lipid metabolism may affect viral replication

How can I optimize experimental conditions for assessing PMP34 transport activity?

For functional characterization of recombinant PMP34:

  • Reconstitution System Optimization:

    • Lipid composition: Test different phospholipid mixtures to mimic peroxisomal membrane

    • Protein-to-lipid ratio: Typically 1:50 to 1:200 range

    • Reconstitution method: Compare detergent dialysis versus direct incorporation

  • Transport Assay Conditions:

    • Buffer composition: pH 7.2-7.6, physiological salt concentration

    • Temperature: 30-37°C optimal for mammalian proteins

    • Time course: Initial rates (15 seconds to 5 minutes) for kinetic analysis

  • Substrate Considerations:

    • Concentration range: 0.1-100 μM for Km determination

    • Radioisotope labeling: [3H] or [14C] labeled substrates for high sensitivity

    • Counter-substrate loading: Pre-load liposomes with counter-substrates to measure exchange

  • Controls and Validation:

    • Ionophore controls to collapse gradients

    • Non-functional mutant protein as negative control

    • Inhibitor profiling using substrate analogs

  • Data Analysis:

    • Initial rate determination from linear phase

    • Michaelis-Menten kinetics analysis

    • Counterflow experiments to confirm exchange mechanism

What is the interplay between PMP34 and the peroxisomal protein import machinery?

PMP34 function may interact with peroxisomal protein import in several ways:

  • Energetic Coupling:

    • PMP34-mediated cofactor transport may provide metabolic energy for protein import

    • CoA transported by PMP34 is required for intraperoxisomal activation steps

  • Structural Analysis:

    • Co-localization studies with import machinery components like PEX5 and PEX14

    • Assessment of protein import efficiency in PMP34-deficient cells

    • Blue native PAGE to identify potential protein complexes involving PMP34

  • Functional Studies:

    • Measurement of matrix protein import in PMP34-deficient versus wild-type peroxisomes

    • Analysis of peroxisomal enzyme activities requiring PMP34-transported cofactors

    • Assessment of peroxisomal redox state dependent on FAD/NAD+ transport

In SARS-CoV-2 infected cells, peroxisomal matrix proteins redistribute to the cytosol, suggesting compromised protein import machinery . Understanding PMP34's relationship with this machinery could provide insights into both normal peroxisome function and pathological states.

What are best practices for generating and validating PMP34 antibodies?

  • Epitope Selection:

    • Target unique, hydrophilic regions (preferably cytosolic loops)

    • Avoid transmembrane domains and regions with high homology to other proteins

    • Consider species-specific regions if cross-reactivity is a concern

  • Validation Approach:

    • Western blotting on wild-type versus knockout tissue

    • Immunofluorescence microscopy with peroxisomal markers

    • Pre-absorption controls with immunizing peptide

    • Multiple antibodies targeting different epitopes

  • Application-specific Validation:

    • For immunoprecipitation: Verify pull-down efficiency

    • For immunohistochemistry: Test fixation conditions thoroughly

    • For electron microscopy: Verify specificity at ultrastructural level

How can I establish reliable models for studying PMP34 function?

  • Cellular Models:

    • CRISPR/Cas9-mediated knockout in relevant cell lines

    • Stable overexpression of tagged constructs

    • Inducible expression systems for temporal control

    • Primary cell isolation from PMP34 knockout mice

  • Animal Models:

    • Conditional knockout strategies to avoid developmental effects

    • Tissue-specific knockouts to assess organ-specific functions

    • Reporter gene knock-ins to track expression patterns

    • Humanized mouse models expressing human PMP34

  • Expression Analysis:

    • qPCR primers spanning multiple exons

    • RNA-seq for comprehensive transcriptome analysis

    • Single-cell approaches to detect cell-type specific expression

What are the most informative experimental challenges to reveal PMP34 function?

Since PMP34 knockout mice show no obvious phenotype under normal conditions, specific challenges can reveal its function:

  • Metabolic Challenges:

    • Dietary phytol supplementation (0.1-0.5% w/w in diet)

    • High-fat diet to stress lipid metabolism

    • Fasting-refeeding protocols to analyze metabolic flexibility

  • Environmental Stressors:

    • Oxidative stress induction

    • Temperature challenges

    • Viral or bacterial infection models

  • Analytical Approaches:

    • Lipidomic profiling before and after challenge

    • Metabolic flux analysis using stable isotopes

    • Temporal transcriptomic and proteomic responses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.