Recombinant Mouse Peroxisome assembly protein 12 (Pex12)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Pex12; Peroxisome assembly protein 12; Peroxin-12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Pex12
Target Protein Sequence
MAEYGAHITTASVADDQPSIFEVVAQDSLMTAVRPALQHVVKVLAESNPAHYGFLWRWFD
EIFTLLDFLLQQHYLSRTSASFSEHFYGLKRIVAGSSPHLQRPASAGLPKEHLWKSAMFL
VLLPYLKVKLEKLASSLREEDEYSIHPPSSRWKRFYRAFLAAYPFVNMAWEGWFLTQQLR
YILGKAEHHSPLLKLAGVRLARLTAQDMQAIKQRLVEASAMQEPVRSVGEKIKSALKKAV
GGVALSLSTGLSVGVFFLQFLDWWYSSENQEAIKSLTALPTPPPPVHLDYNSDSPLLPKM
KTVCPLCRKTRVNDTVLATSGYVFCYRCVFNYVRSHQACPITGYPTEVQHLIKLYSPEN
Uniprot No.
Target Background
Function
Essential for protein import into peroxisomes.
Database Links
Protein Families
Pex2/pex10/pex12 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
