Recombinant Mouse Peroxisome biogenesis factor 2 (Pex2)

Shipped with Ice Packs
In Stock

Description

Production and Characteristics

Recombinant Pex2 is synthesized through heterologous expression systems, typically in E. coli or other host organisms. Key production parameters include:

ParameterDetails
Host SystemE. coli, yeast, or mammalian cells (e.g., HEK293)
TagN-terminal His-tag for purification
Purity>90% (via SDS-PAGE analysis)
StorageLyophilized; stored at -80°C for long-term stability
Reconstitution BufferPBS (pH 7.4) with additives like trehalose and DTT

The recombinant protein retains functional domains, including a RING zinc finger motif critical for ubiquitination activity .

Biochemical Functions

Pex2 functions as an E3 ubiquitin ligase in peroxisomal biogenesis, working in concert with other peroxins (e.g., Pex10, Pex12) to regulate the import receptor Pex5:

  • Polyubiquitination: Mediates Ubc4-dependent polyubiquitination of Pex5, targeting it for proteasomal degradation .

  • Monoubiquitination: Facilitates Pex4-dependent monoubiquitination of Pex5, enabling receptor recycling .

  • Protein Interactions: Binds Pex5 and other peroxins to form translocation complexes .

3.1. Studies on Peroxisomal Biogenesis Disorders

Defects in PEX2 are linked to Zellweger syndrome and infantile Refsum disease. Recombinant Pex2 is used to model these disorders and investigate:

  • Peroxisome Deficiency: Impaired peroxisome biogenesis disrupts neural stem cell maintenance and BDNF signaling in Pex2-KD mice .

  • BDNF-TrkB Signaling: Upregulation of BDNF and TrkB-T1 in hippocampal tissues correlates with memory deficits in peroxisome-deficient models .

3.2. Neurological and Cellular Studies

Study FocusKey FindingsCitations
Neural Stem Cell DynamicsReduced nestin-positive cells and radial processes in Pex2-KD mice SGZ
BDNF RegulationElevated BDNF protein/mRNA levels in hippocampus of Pex2-KD mice
Ubiquitination MechanismsPex2-Pex5 interaction critical for receptor cycling and peroxisome import

4.1. Production and Quality Control

AttributeDetails
Expression HostE. coli (His-tagged) or mammalian cells (untagged)
Concentration200 µg/ml (prior to lyophilization)
ActivityNot tested for enzymatic activity; validated for Western blot

4.2. Applications in Assays

ApplicationMethodOutcome
Western BlottingDetection of Pex2 in lysates or recombinant samples Band at ~35 kDa (native protein size)
ELISAQuantification of Pex2 in biological samples Sensitivity dependent on antibody pair

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us in advance, and we will prioritize its development.
Synonyms
Pex2; Paf1; Pmp35; Pxmp3; Peroxisome biogenesis factor 2; Peroxin-2; Peroxisomal membrane protein 3; Peroxisome assembly factor 1; PAF-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Pex2
Target Protein Sequence
MAAREESTQSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVKAFL WLFLWRFTIYSKNATVGQSVLNIQHKNDSSPNPVYQPPSKNQKLLYAVCTIGGRWLEERC YDLFRNRHLASFGKAKQCMNFVVGLLKLGELMNFLIFLQKGKFATLTERLLGIHSVFCKP QNMREVGFEYMNRELLWHGFAEFLIFLLPLINIQKLKAKLSSWCTLCTGAAGHDSTLGSS GKECALCGEWPTMPHTIGCEHVFCYYCVKSSFLFDIYFTCPKCGTEVHSVQPLKAGIQMS EVNAL
Uniprot No.

Target Background

Function
Involved in peroxisome biogenesis.
Gene References Into Functions
  • PEX2 is essential for peroxisome autophagy under starvation conditions. PMID: 27597759
Database Links

KEGG: mmu:19302

UniGene: Mm.132336

Protein Families
Pex2/pex10/pex12 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.

Q&A

What is the molecular function of PEX2 in peroxisome biogenesis?

PEX2 functions as an integral peroxisomal membrane protein (35kDa) essential for peroxisome biogenesis and matrix protein import. The protein contains a zinc-finger domain that confers E3 ubiquitin ligase activity, enabling it to participate in protein ubiquitination processes critical for peroxisome function and maintenance . This ligase activity is particularly important as PEX2 has been confirmed to mediate peroxisome degradation (pexophagy) during starvation conditions . When designing experiments with recombinant PEX2, researchers should consider that PEX2's RING-domain is essential for its E3 ligase functionality, as deletion constructs lacking this domain (such as PEX2-Δ243-283-GFP) fail to induce peroxisome loss .

What are the key structural domains of mouse PEX2 protein that should be preserved in recombinant forms?

The mouse PEX2 protein consists of 305 amino acids with several critical domains that must be maintained in functional recombinant forms . Most importantly, the C-terminal RING-finger domain (approximately residues 243-283) is essential for E3 ubiquitin ligase activity . When preparing recombinant constructs, researchers should particularly preserve the zinc-binding regions critical for E2-binding interactions (around residues 270-283) . Additionally, the transmembrane domains must be correctly folded to ensure proper insertion into the peroxisome membrane. Experimental evidence has demonstrated that deletion mutants lacking the C-terminus (PEX2-Δ243-306) or specifically the RING-finger domain cannot induce peroxisomal degradation, confirming these regions are essential for protein function .

How does PEX2 interact with other peroxins in the biogenesis pathway?

PEX2 functions within a complex network of protein interactions essential for peroxisome biogenesis and maintenance. Key interaction partners include PEX19, PEX14, and PEX5, which collectively facilitate peroxisomal matrix protein import . PEX19 likely aids in the proper targeting and insertion of PEX2 into the peroxisomal membrane as part of the membrane protein import machinery. For functional studies, researchers should consider that PEX2 also interacts with ubiquitination machinery components including UBE2A and UBE2B, which serve as E2 ubiquitin-conjugating enzymes that work with PEX2's E3 ligase activity . These protein-protein interactions can be verified through co-immunoprecipitation experiments, yeast two-hybrid screens, or proximity-labeling approaches when working with recombinant PEX2 proteins.

What expression systems are most effective for producing functional recombinant mouse PEX2?

Producing functional recombinant mouse PEX2 requires careful consideration of expression systems that maintain protein folding and post-translational modifications. Based on available data, mammalian expression systems (particularly HEK293 cells) have demonstrated successful production of functional PEX2 . When expressing PEX2 for experimental applications, researchers should consider:

  • For structural studies: E. coli systems may be suitable for producing isolated domains, but complete functional protein usually requires eukaryotic expression systems due to the membrane insertion requirements.

  • For functional studies: Mammalian cell lines (HEK293, CHO) have been successfully used to express tagged versions of PEX2 (PEX2-GFP, PEX2-FLAG) that maintain E3 ligase activity .

  • For interaction studies: Insect cell systems offer a compromise between yield and proper folding/post-translational modifications.

Regardless of the chosen system, purification should include detergent strategies appropriate for membrane proteins, and functionality should be validated through ubiquitination assays using purified components .

How can researchers effectively design PEX2 knockout or knockdown experiments to study peroxisome dynamics?

Experimental approaches for manipulating PEX2 expression require careful consideration of control conditions and phenotypic validation. For knockout studies, researchers have successfully used complete PEX2 gene deletion in mice as demonstrated in developmental studies . For cellular studies, siRNA-mediated knockdown approaches have proven effective with multiple validated siRNA sequences available (such as siPEX2-1 and siPEX2-2) .

When conducting knockdown experiments, researchers should:

  • Validate knockdown efficiency using both RT-qPCR and Western blot analysis

  • Include rescue experiments with siRNA-resistant constructs (e.g., PEX2-siR-FLAG) to confirm phenotype specificity

  • Monitor peroxisome density using standard markers like PMP70

  • Include appropriate controls for both unperturbed conditions and non-targeting siRNA

Notably, PEX2 depletion results in increased peroxisome density even under normal growth conditions (DMEM), suggesting its role in basal peroxisome turnover . This baseline change should be accounted for when designing experiments examining specific stressors or conditions.

What methodologies are recommended for studying PEX2-mediated ubiquitination in peroxisome research?

To investigate PEX2's E3 ubiquitin ligase activity in experimental settings, researchers should consider the following methodologies:

  • In vitro ubiquitination assays: Recombinant PEX2 can be used in reconstituted systems with E1, E2 (preferably UBE2A or UBE2B), ubiquitin, ATP, and potential substrate proteins to assess direct ubiquitination activity .

  • Cellular ubiquitination analysis: Experiments can detect ubiquitinated peroxisomal proteins following PEX2 overexpression through immunoprecipitation of peroxisomal fractions followed by ubiquitin immunoblotting. This approach has revealed increased ubiquitination of peroxisomal proteins when PEX2 is overexpressed .

  • Mutational analysis: Comparing wild-type PEX2 with RING domain mutants (such as PEX2-Δ243-283-GFP or PEX2-Δ270-283-GFP) can help identify essential residues for E3 ligase activity . Critical point mutations in the zinc-coordinating residues can further refine understanding of structure-function relationships.

These methods collectively provide robust approaches for characterizing the molecular mechanisms of PEX2-mediated peroxisomal protein ubiquitination.

How does PEX2 expression respond to cellular stress conditions, and what signaling pathways regulate this response?

PEX2 expression exhibits significant responsiveness to cellular stress conditions, particularly nutrient deprivation. Research has established that amino acid starvation induces upregulation of PEX2 expression, which correlates with increased peroxisome degradation through autophagy . Similarly, rapamycin treatment (an mTORC1 inhibitor) increases PEX2 expression, strongly suggesting regulation through the mTORC1 signaling pathway .

For investigating this regulatory relationship, researchers should design experiments that:

  • Monitor PEX2 expression levels (mRNA and protein) under various stressors using RT-qPCR and immunoblotting

  • Employ inhibitors and activators of mTORC1 pathway components

  • Utilize reporter constructs with the PEX2 promoter to identify responsive elements

  • Consider additional stress pathways that might integrate with peroxisome homeostasis

The regulatory relationship appears bidirectional, as PEX2 depletion affects peroxisome numbers even under normal growth conditions, indicating a role in both basal turnover and stress-induced pexophagy .

What is the role of PEX2 in the pathogenesis of peroxisomal disorders, and how can recombinant PEX2 be used to study these conditions?

PEX2 mutations are directly implicated in human peroxisomal biogenesis disorders, particularly Zellweger syndrome and infantile Refsum disease . The mouse PEX2 knockout model recapitulates many features of human peroxisomal disorders, including:

  • Empty peroxisome membrane ghosts

  • Accumulation of very long chain fatty acids

  • Deficient erythrocyte plasmalogens

  • Abnormal lipid storage in adrenal cortex

  • Disordered lamination in cerebral cortex

  • Neuronal migration defects

For researchers studying peroxisomal disorders, recombinant PEX2 can be used to:

  • Perform structure-function analyses of disease-causing mutations

  • Develop rescue experiments in patient-derived or engineered PEX2-deficient cell lines

  • Screen for small molecules that might stabilize mutant PEX2 or bypass its function

  • Study interaction profiles of wild-type versus mutant PEX2 to understand pathogenic mechanisms

The majority of pathogenic mutations are nonsense mutations leading to premature termination of the protein, highlighting the essential nature of the complete protein structure for function .

What is the relationship between PEX2-mediated pexophagy and the autophagy machinery?

The selective degradation of peroxisomes (pexophagy) mediated by PEX2 involves complex interactions with the cellular autophagy machinery. Experimental evidence demonstrates that PEX2-induced peroxisome loss requires functional autophagy components . The mechanism follows this general pathway:

  • PEX2's E3 ligase activity ubiquitinates peroxisomal membrane proteins

  • The autophagy receptor NBR1 recognizes ubiquitinated peroxisomes

  • NBR1 recruitment is essential for PEX2-mediated pexophagy, while p62 plays an auxiliary role

  • The core autophagy machinery (requiring ATG5) then facilitates peroxisome degradation

This relationship has been experimentally validated through:

  • Loss of PEX2-induced peroxisome degradation in ATG5-/- MEFs

  • Colocalization of autophagy markers (LC3, Lamp1) with peroxisomes in PEX2-overexpressing cells

  • Requirement of NBR1 but not p62 for PEX2-mediated peroxisome loss

For researchers, this signifies that experimental designs must consider the interdependence of ubiquitination, receptor recruitment, and autophagosome formation when studying PEX2 function.

What are common challenges in interpreting peroxisome quantification data when manipulating PEX2 expression?

When quantifying peroxisomes in PEX2 manipulation experiments, researchers should be aware of several methodological considerations:

  • Peroxisome clustering versus degradation: PEX2 overexpression can induce peroxisome clustering prior to degradation, which can complicate simple counting methods. This clustering is particularly evident in cells expressing PEX2-GFP and appears to be part of the degradation process .

  • Recommended quantification approaches:

    • Measure both peroxisome density (numbers per cell) AND total fluorescence of peroxisomal markers

    • Quantify the sum of intensities of all fluorescent voxels within peroxisomal marker-positive puncta

    • Use multiple independent peroxisomal markers (PMP70, catalase) to confirm observations

  • Appropriate controls: Include both mock-transfected cells and cells expressing a non-functional peroxisomal protein (e.g., PMP34-GFP) to distinguish PEX2-specific effects from general peroxisome perturbations .

Researchers should also account for baseline differences in peroxisome numbers when PEX2 is depleted, as this affects interpretation of additional experimental manipulations .

How should researchers interpret contradictory results between in vitro and in vivo PEX2 studies?

Discrepancies between in vitro and in vivo findings related to PEX2 function are not uncommon and require careful interpretation. When confronted with such contradictions, researchers should consider:

  • System-specific differences:

    • The severity of the PEX2 knockout phenotype in mice (lethal shortly after birth) may limit certain types of analyses possible in cell culture

    • Compensatory mechanisms may exist in vivo that are absent in cellular systems

  • Temporal dynamics:

    • Acute manipulation (siRNA, overexpression) may produce effects different from chronic absence (knockout models)

    • Developmental timing may be critical, as PEX2-deficient mice show specific neuronal migration defects that occur during embryogenesis

  • Resolution strategies:

    • Use conditional/inducible knockout models to bridge acute and chronic manipulation

    • Validate key findings in primary cells derived from animal models

    • Consider tissue-specific differences in PEX2 function and regulation

For example, while cell culture studies might focus on PEX2's role in pexophagy, the mouse knockout model reveals broader developmental abnormalities that might not be apparent in short-term cellular experiments .

What technical considerations are important when using tagged recombinant PEX2 proteins in imaging studies?

When using tagged recombinant PEX2 proteins for microscopy and imaging applications, researchers must address several technical challenges:

  • Tag position effects:

    • C-terminal tags (GFP, FLAG) have been successfully used without disrupting PEX2 function

    • N-terminal tags may interfere with membrane insertion and should be validated carefully

  • Expression level considerations:

    • Even modest overexpression of PEX2 induces peroxisome degradation, complicating imaging of steady-state localization

    • Use inducible expression systems or very early time points after transfection to capture normal localization

    • Consider using catalase or PMP70 as co-markers for peroxisomes

  • Fixation and permeabilization methods:

    • Standard paraformaldehyde fixation works for most applications

    • Permeabilization conditions may affect retention of membrane-bound PEX2

    • For colocalization studies with NBR1, LC3, or Lamp1, optimize fixation to preserve all markers

When interpreting imaging data, researchers should be aware that peroxisome clustering precedes degradation when PEX2 is overexpressed , which may appear as enlarged peroxisomes rather than distinct clustered organelles depending on resolution.

What are emerging areas of research regarding PEX2's role beyond peroxisome biogenesis?

Beyond its established roles in peroxisome biogenesis and pexophagy, PEX2 research is expanding into several promising directions:

  • Metabolic regulation: PEX2's responsiveness to nutrient status suggests it may serve as a key integrator of metabolic signals and peroxisome function. Future research should investigate how PEX2 activity coordinates with cellular metabolic needs, particularly in tissues with high peroxisomal activity like liver and kidney .

  • Cell type-specific functions: While most studies have used standard cell lines, examining PEX2 in specialized cell types (neurons, hepatocytes, adipocytes) may reveal tissue-specific regulation and functions. The neuronal migration defects in PEX2-deficient mice highlight potential neuron-specific roles .

  • Integration with other cellular pathways: Emerging evidence suggests connections between peroxisomal function and mitochondrial dynamics, ER stress responses, and inflammatory pathways. PEX2's position as a regulatory E3 ligase may extend to these inter-organellar communication networks.

  • Identification of PEX2 substrates: A comprehensive characterization of PEX2's ubiquitination targets would significantly advance understanding of its molecular mechanisms. Proteomics approaches coupling PEX2 manipulation with ubiquitin profiling represent a promising strategy.

These research directions extend beyond the traditional focus on peroxisome biogenesis disorders to broader cellular homeostasis mechanisms.

How might recombinant PEX2 be utilized in developing therapeutic approaches for peroxisomal disorders?

The development of therapeutic strategies for peroxisomal disorders could benefit significantly from recombinant PEX2 research through several approaches:

  • Drug screening platforms:

    • Utilize recombinant PEX2 in high-throughput screens to identify small molecules that:

    • Modulate PEX2 E3 ligase activity

    • Stabilize mutant PEX2 proteins

    • Compensate for PEX2 deficiency by activating alternative pathways

  • Gene therapy development:

    • Recombinant PEX2 studies can inform optimal delivery constructs for gene therapy

    • Functional minimization studies can determine the smallest functional PEX2 domain necessary for therapeutic effect

    • Mouse models provide essential platforms for testing delivery and efficacy

  • Personalized medicine approaches:

    • Characterization of patient-specific mutations using recombinant proteins

    • Development of mutation-specific interventions

    • Identification of biomarkers for monitoring treatment efficacy

The severe consequences of PEX2 deficiency in mouse models highlight the importance of developing effective therapies, particularly for addressing the neurological manifestations that occur during development .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.