Recombinant Mouse PH and SEC7 domain-containing protein 2 (Psd2)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Cellular Processes

ARF6 Activation:
Psd2 acts as a guanine nucleotide exchange factor (GEF) for ARF6, a GTPase regulating dendritic spine formation and synaptic plasticity in cerebellar Purkinje cells . Studies using Psd2-knockout mice revealed impaired motor coordination, linking Psd2 to cerebellar function .

Phosphatidylserine Decarboxylation:
Psd2 catalyzes phosphatidylethanolamine (PE) synthesis in endosomes. While mitochondrial Psd1 produces ~70% of cellular PE, Psd2 contributes the remaining 30%, specifically influencing vacuolar membrane PE levels in yeast models .

Cadmium Tolerance:
Loss of Psd2 in S. cerevisiae causes cadmium sensitivity due to disrupted vacuolar PE synthesis, which affects Ycf1 transporter activity .

Interaction Partners:

  • PstB2: Forms a complex with Psd2 for phosphatidylserine transport; the N-terminal region of Psd2 is sufficient for this interaction .

  • Sfh4: A phosphatidylinositol transfer protein (PITP) required for Psd2 activation, independent of its lipid-transfer activity .

Subcellular Localization:

  • Psd2 localizes to endosomal compartments and peripheral membrane regions, colocalizing with ARF6 and EEA-1 in glioblastoma cells .

Applications in Research Tools

ELISA Kits:

  • Mouse Psd2 ELISA Kit (Abbexa, Cat# CSB-CF744030MO) detects Psd2 in tissue homogenates with a sensitivity range of 0.156–10 ng/ml .

Antibodies:

Antibody Code (CUSABIO)Species ReactivityApplications
CSB-PA018843GA01HUHuman, Mouse, RatWB, ELISA
CSB-PA579340XA01DOAArabidopsisWB, ELISA

Challenges and Future Directions

  • BFA Insensitivity: Unlike other ARF GEPs, Psd2 is resistant to brefeldin A due to Phe535 and Ala536 substitutions in its Sec7 domain .

  • Therapeutic Potential: Psd2’s role in neurodevelopment and lipid metabolism makes it a target for neurodegenerative diseases and cancer .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
Psd2; Efa6c; PH and SEC7 domain-containing protein 2; Exchange factor for ADP-ribosylation factor guanine nucleotide factor 6 C; Exchange factor for ARF6 C; Pleckstrin homology and SEC7 domain-containing protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-770
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MDEEKLPCELHKEGSATQEDHGLEPEEEPGLQNGTAASEGLSSHISGPGGEKTLEGTMEP VRGPDVALPGLNLSLTNGLALGQDGNILEDSIEFKTWRSGPAEEEDVPGSPCPDAGDPQL GLDCPGEPDVRDGFSATFEKILESELLRGTQYSSLDSLDVLSLTDESDSCVSFEAPLTPL IQQRARDSPEAGAGLGNGDMGPEGDLGATGGCDGELGSPLRRSISSSRSENVLSHLSLTS VPNGFHEDGPGGSGGDDEDDEDTDKLLNSASDTSLKDGLSDSDSELSSSEGLEPGSTDPL ANGCQGVSEAARRLARRLYHLEGFQRCDVARQLGKNNEFSRLVAGEYLSFFDFSGLTLDR ALRTFLKAFPLMGETQERERVLTHFSRRYCQCNPDDSTSEDGIHTLTCALMLLNTDLHGH NIGKKMSCQQFIANLDQLNDGQDFAKDLLKTLYNSIKNEKLEWAIDEDELRKSLSELVDD KFGTGTKKVTRILDGGNPFLDVPQALNATTYKHGVLTRKTHADMDGKRTPRGRRGWKKFY AVLKGTILYLQKDEYRLDKALSEGDLKNAIRVHHALATRASDYSKKSNVLKLKTADWRVF LFQAPSKEEMLSWILRINLVAAIFSAPAFPAAVSSMKKFCRPLLPSCTTRLCQEEQLRSH ENKLRQVTAELAEHRCHPLERGLKSKEAEEYRLKEHYLTFEKSRYETYIHLLAVKIKVGS DDLERIEARLATIEGDDPALRKTHSSPALSLGHGPVTGSKATKDTSASDT
Uniprot No.

Target Background

Database Links
Protein Families
PSD family
Subcellular Location
Cell membrane; Single-pass membrane protein. Cell projection, ruffle membrane. Cleavage furrow.

Q&A

What is Psd2 and what domains does it contain?

Psd2 (Pleckstrin and Sec7 Domain-containing protein 2) is a guanine nucleotide exchange factor (GEF) characterized by the presence of both PH (Pleckstrin Homology) and Sec7 domains. The Sec7 domain, approximately 200 amino acids in length, is critical for catalyzing nucleotide exchange on ADP-ribosylation factor (Arf) GTPases, which are key regulators of intracellular protein trafficking . The observed molecular weight of Psd2 in mouse brain tissue is approximately 85-95 kDa when detected by Western blot techniques . Psd2 belongs to a phylogenetically conserved family of Sec7-domain-containing proteins that are distributed across fungi, plants, and animals, indicating its evolutionary significance in eukaryotic cellular processes .

What are the primary research applications for studying Psd2?

Psd2 research primarily employs techniques such as Western blotting (WB) and Enzyme-Linked Immunosorbent Assay (ELISA) . These methodological approaches enable researchers to:

  • Detect and quantify Psd2 expression levels in various tissues

  • Analyze protein-protein interactions between Psd2 and Arf GTPases

  • Investigate the role of Psd2 in intracellular trafficking pathways

  • Examine the impact of mutations in Psd2 on its GEF activity

  • Study the structural relationships between the PH and Sec7 domains

When designing experiments to study Psd2, researchers should consider using appropriate antibodies with confirmed specificity. For instance, antigen affinity-purified polyclonal antibodies raised against Psd2 recombinant protein have demonstrated reliable detection in mouse brain tissue samples .

What species conservation exists for Psd2?

Psd2 exhibits significant conservation across mammalian species. Current antibodies have demonstrated reactivity with human, mouse, and rat Psd2 orthologs . Phylogenetic analysis of Sec7-domain-containing proteins has revealed seven main evolutionary groups, with two groups containing members from all major model organisms (fungi, plants, and animals) . This conservation suggests fundamental biological importance across eukaryotic lineages. When designing cross-species experiments, researchers should consider the degree of sequence homology in the targeted epitopes to ensure reliable detection across different model organisms.

What are the optimal conditions for detecting Psd2 in Western blot experiments?

For successful Western blot detection of Psd2, researchers should implement the following methodological approach:

ParameterRecommended ConditionNotes
Antibody Dilution1:500-1:5000Titration may be necessary for optimal signal-to-noise ratio
Sample SourceBrain tissue (validated)Other tissues require validation
Expected MW85-95 kDaConfirms specificity of detection
Blocking Solution5% non-fat milk in TBSTReduces non-specific binding
Detection SystemHRP-conjugated secondary antibodyECL-based visualization recommended
Loading Controlβ-actin or GAPDHEnsures equal loading across samples

When performing Western blot analysis, it is crucial to include positive controls from validated tissue sources such as mouse brain . The relatively high molecular weight of Psd2 (85-95 kDa) requires careful optimization of protein transfer conditions to ensure complete transfer to the membrane. Extended transfer times or specialized transfer buffers for high molecular weight proteins may improve detection sensitivity.

How should researchers design experiments to study Psd2's guanine nucleotide exchange activity?

When investigating the GEF activity of Psd2, researchers should consider the following experimental design:

  • Protein Purification Strategy: Express and purify recombinant Psd2 or its isolated Sec7 domain using affinity chromatography techniques. The Sec7 domain alone (approximately 200 amino acids) is sufficient to catalyze exchange on Arf GTPases .

  • Nucleotide Exchange Assay: Monitor the exchange of GDP for GTP on purified Arf proteins using fluorescently labeled nucleotide analogs (e.g., mant-GDP or mant-GTP).

  • Inhibitor Studies: Include brefeldin A (BFA) as a control inhibitor. BFA blocks GEF activity by binding to both the Sec7 domain and Arf, freezing the Sec7-domain-Arf-GDP complex in an early intermediate state of the exchange reaction .

  • Structural Considerations: Design experiments that account for the conformational changes in both the Sec7 domain and Arf during the exchange process. The binding of Arf-GDP to the Sec7 domain results in closure of the Sec7-domain hydrophobic groove, triggering the protrusion of the catalytic glutamate residue .

  • Data Analysis: Calculate exchange rates under varying conditions and substrate concentrations to determine kinetic parameters (kcat, Km) for Psd2's GEF activity.

How do the PH and Sec7 domains functionally interact within Psd2?

The functional interaction between the PH and Sec7 domains in Psd2 represents a complex regulatory mechanism that controls guanine nucleotide exchange activity. Current research suggests that:

  • The PH domain may serve as a membrane-targeting module, localizing Psd2 to specific subcellular compartments through phospholipid binding.

  • Intramolecular interactions between the PH and Sec7 domains potentially regulate the accessibility of the catalytic site in the Sec7 domain.

  • The three-dimensional arrangement of these domains creates a specific spatial orientation that facilitates optimal interaction with Arf substrates.

The conformational changes that occur in the Sec7 domain during Arf binding and nucleotide exchange likely influence the orientation of the adjacent PH domain . This structural interplay may represent a regulatory mechanism that coordinates GEF activity with membrane localization. Future research directions should focus on resolving the crystal structure of full-length Psd2 to better understand these domain interactions.

What methods can resolve contradictory data regarding Psd2 subcellular localization?

Researchers frequently encounter contradictory data regarding Psd2 subcellular localization. To address these discrepancies, the following methodological approaches are recommended:

  • Multi-technique Validation: Combine immunofluorescence, subcellular fractionation, and proximity labeling techniques (BioID or APEX) to triangulate localization data.

  • Temporal Resolution: Implement live-cell imaging with fluorescently tagged Psd2 to capture dynamic localization changes that may be missed in fixed-cell approaches.

  • Isoform-specific Analysis: Design experiments that discriminate between potential splice variants of Psd2, which may localize to different subcellular compartments.

  • Stimulation-dependent Studies: Examine Psd2 localization under various cellular stimuli to determine if contradictory results reflect different cellular states.

  • Quantitative Co-localization: Apply rigorous statistical analysis to co-localization studies, including Pearson's correlation coefficient and Manders' overlap coefficient calculations.

Different Sec7-domain proteins exhibit distinct patterns of intracellular localization, which correlates with their specific biological functions . Therefore, precise characterization of Psd2 localization is essential for understanding its role in cellular processes.

What are the methodological challenges in studying Psd2-Arf interactions in vivo?

Investigating Psd2-Arf interactions in living systems presents several methodological challenges that researchers must address:

  • Transient Nature of Interactions: The GEF-substrate interaction is inherently transient, making it difficult to capture using traditional co-immunoprecipitation approaches. Researchers should consider implementing chemical crosslinking or proximity-dependent labeling methods.

  • Multiple Arf Substrates: Psd2 may interact with multiple Arf GTPase family members with different affinities. Comprehensive analysis requires systematic testing against all potential Arf substrates.

  • Spatial Regulation: The interaction likely occurs in specific membrane microdomains, necessitating methods that preserve membrane architecture, such as in situ proximity ligation assays.

  • Temporal Dynamics: The exchange reaction occurs rapidly, requiring high temporal resolution techniques such as FRET-based biosensors to monitor the interaction kinetics in real-time.

  • Physiological Relevance: In vitro preference for certain Arf substrates may not reflect physiological specificity in vivo . Researchers should validate findings using cellular systems with endogenous expression levels.

How can CRISPR-Cas9 gene editing advance our understanding of Psd2 function?

CRISPR-Cas9 technology offers powerful approaches for investigating Psd2 function through precise genetic manipulation:

  • Domain-specific Mutagenesis: Generate targeted mutations in catalytic residues within the Sec7 domain to create separation-of-function mutants.

  • Endogenous Tagging: Insert fluorescent protein or epitope tags at the endogenous Psd2 locus to study the protein under physiological expression conditions.

  • Conditional Knockout Systems: Implement inducible Psd2 deletion to study acute versus chronic loss of function, avoiding developmental compensation effects.

  • Paralog Replacement: Replace Psd2 with other Sec7-domain family members to assess functional redundancy within the seven phylogenetic groups identified in previous studies .

  • Humanized Mouse Models: Generate knock-in models expressing human Psd2 variants to study species-specific functions and disease-associated mutations.

When designing CRISPR-Cas9 experiments, researchers should carefully consider potential off-target effects and implement appropriate controls, including rescue experiments with wildtype Psd2 to confirm phenotype specificity.

What methodological approaches can elucidate the role of Psd2 in neuronal development and function?

Given the detection of Psd2 in mouse brain tissue , investigating its neuronal functions requires specialized methodological approaches:

  • Primary Neuronal Cultures: Utilize primary neuronal cultures from Psd2 knockout or knockdown models to examine effects on neuronal morphology, synapse formation, and electrophysiological properties.

  • Brain Region-specific Analysis: Implement laser capture microdissection to isolate specific brain regions for comparative analysis of Psd2 expression and function.

  • Circuit-level Investigation: Use viral-mediated gene transfer to manipulate Psd2 expression in defined neuronal circuits, combined with behavioral testing to link molecular function to systems-level outcomes.

  • Developmental Timecourse Studies: Perform temporal analysis of Psd2 expression during critical periods of neuronal development to identify stage-specific functions.

  • Proteomic Analysis: Conduct brain-specific interactome studies to identify neuronal-specific binding partners that may confer tissue-specific functions.

The observed expression of Psd2 in brain tissue suggests potential roles in neuronal membrane trafficking, receptor recycling, or synaptic vesicle dynamics that warrant detailed investigation.

What strategies can resolve non-specific binding when using Psd2 antibodies?

Researchers frequently encounter non-specific binding when using antibodies against Psd2. To mitigate this issue, implement the following methodological solutions:

  • Antibody Validation: Confirm antibody specificity using tissues from Psd2 knockout models or siRNA-mediated knockdown samples.

  • Blocking Optimization: Test different blocking solutions (e.g., BSA, casein, commercial blocking buffers) to identify optimal conditions for reducing background.

  • Antibody Concentration Titration: Perform systematic dilution series to identify the optimal antibody concentration that maximizes specific signal while minimizing background.

  • Pre-adsorption Controls: Pre-incubate the antibody with excess recombinant Psd2 protein to confirm signal specificity.

  • Cross-reactivity Assessment: Test the antibody against related Sec7-domain family members to evaluate potential cross-reactivity with proteins in the same phylogenetic group .

For the commercially available PSD2 Rabbit Polyclonal antibody, validation in mouse brain tissue has been performed at a dilution of 1:1500, which may serve as a starting point for optimization in new experimental systems .

How can researchers ensure reproducibility in Psd2 functional assays?

Ensuring reproducibility in functional assays for Psd2 requires rigorous methodological standardization:

Quality Control ParameterRecommended Approach
Protein PurityVerify recombinant Psd2 purity by SDS-PAGE (>95% purity)
Protein ActivityInclude positive controls for GEF activity in each assay
Substrate QualityUse freshly prepared or properly stored Arf proteins
Assay ConditionsStandardize buffer components, pH, temperature, and incubation times
Data NormalizationImplement internal controls for plate-to-plate variation
Statistical AnalysisPre-determine sample size and exclusion criteria

The complex structure-function relationship in Sec7-domain proteins requires careful experimental design. Researchers should consider that different Sec7-domain proteins exhibit distinct patterns of intracellular localization and biological function, even within the same phylogenetic group . This functional diversity necessitates precise characterization of experimental conditions when studying Psd2 specifically.

What are the most promising future research directions for Psd2 investigation?

Based on current understanding of Sec7-domain-containing proteins and their phylogenetic distribution, several high-priority research directions emerge for Psd2:

  • Comprehensive structural analysis of full-length Psd2, including the relationship between PH and Sec7 domains in regulating GEF activity.

  • Identification of tissue-specific functions, particularly in brain tissue where Psd2 has been detected .

  • Integration of Psd2 into larger signaling networks that regulate membrane trafficking and protein sorting.

  • Comparative analysis of Psd2 with other members of its phylogenetic group to establish functional conservation and specialization.

  • Investigation of potential roles in human disease processes, particularly neurodevelopmental or neurodegenerative conditions given its brain expression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.