Recombinant Mouse Phosphate carrier protein, mitochondrial (Slc25a3)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mouse Phosphate Carrier Protein (Slc25a3)

The recombinant mouse phosphate carrier protein (Slc25a3), encoded by the SLC25A3 gene, is a mitochondrial solute carrier essential for transporting inorganic phosphate (Pi) into the mitochondrial matrix to sustain oxidative phosphorylation. This protein exists in two isoforms (A and B), generated via alternative splicing of exon 3, with isoform A expressed predominantly in cardiac and skeletal muscle and isoform B ubiquitously expressed . Recombinant versions are engineered for research to study mitochondrial energy metabolism, disease modeling, and therapeutic development.

2.1. Molecular Structure

  • Amino Acid Sequence: The mouse Slc25a3 protein (UniProt ID: Q8VEM8) spans residues 46–357, with a His-tag for purification. It contains six transmembrane domains, forming a multi-pass structure in the mitochondrial inner membrane .

  • Isoforms:

    FeatureIsoform AIsoform B
    Tissue ExpressionCardiac, skeletal muscleUbiquitous
    Phosphate TransportHigher substrate affinityHigher maximal transport rate
    Exon 3 Sequence42 amino acids41 amino acids
    Data synthesized from .

2.2. Functional Roles

  • Primary Function: Facilitates Pi uptake into mitochondria for ATP synthesis via oxidative phosphorylation .

  • Secondary Roles:

    • Copper Transport: Slc25a3 imports copper ions into mitochondria, supporting cytochrome c oxidase (COX) assembly .

    • Mitochondrial Stress Response: Interacts with cyclophilin D and viral inhibitors of apoptosis, modulating cell survival pathways .

3.1. Disease Modeling

  • Mitochondrial Cardiomyopathy: Tamoxifen-induced deletion of Slc25a3 in adult cardiomyocytes causes reduced ATP synthesis, hypertrophic cardiomyopathy, and lactic acidosis, mimicking human mitochondrial phosphate carrier deficiency (MPCD) .

  • Copper-Dependent Pathways: Slc25a3 knockdown in yeast (pic2Δ) rescues COX defects under copper limitation, highlighting its role in metal transport .

3.2. Biochemical Studies

  • Liposome Reconstitution: Recombinant Slc25a3-A and Slc25a3-B isoforms transport Pi and Cu²⁺ into liposomes, with affinities of ~15 μM for copper .

  • Cellular Interactions: Slc25a3 binds to anionic copper chelates (e.g., glutathione-Cu complexes), suggesting a mechanism for copper import .

5.1. Pathophysiological Insights

  • MPCD in Humans: Mutations in SLC25A3 isoform A cause lactic acidosis, hypertrophic cardiomyopathy, and neonatal lethality due to disrupted ATP synthesis .

  • Acylome Remodeling: Slc25a3 deletion in mice triggers mitochondrial acetylation and malonylation, linking energy deficits to post-translational modifications .

5.2. Therapeutic Implications

  • Copper Supplementation: Rescues COX activity in Slc25a3-deficient cells, suggesting potential therapeutic strategies for mitochondrial disorders .

  • Cross-Species Conservation: High sequence homology (48% identity) between mouse Slc25a3 and yeast PiC2 enables comparative studies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Slc25a3; Phosphate carrier protein, mitochondrial; Phosphate transport protein; PTP; Solute carrier family 25 member 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
46-357
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Slc25a3
Target Protein Sequence
AVEEYSCEFGSMKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSIT LKEDGVRGLAKGWAPTLIGYSMQGLCKFGFYEVFKALYSNILGEENTYLWRTSLYLASSA SAEFFADIALAPMEAAKVRIQTQPGYANTLREAVPKMYKEEGLNAFYKGVAPLWMRQIPY TMMKFACFERTVEALYKFVVPKPRSECTKAEQLVVTFVAGYIAGVFCAIVSHPADSVVSV LNKEKGSTASQVLQRLGFRGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEM PESLKKKLGLTE
Uniprot No.

Target Background

Function
This protein facilitates the transport of phosphate groups from the cytosol into the mitochondrial matrix, coupled with H+ co-transport. It may also play a regulatory role in the mitochondrial permeability transition pore (mPTP).
Gene References Into Functions
  1. Evidence suggests the mitochondrial PiC is not a critical component of the MPT pore. PMID: 24768964
  2. Studies indicate that miR-141 regulates Slc25a3 protein expression in the diabetic heart. Furthermore, diabetes-induced miRNA changes may affect mitochondrial proteomes and functions, such as ATP production. PMID: 23034391
Database Links

KEGG: mmu:18674

STRING: 10090.ENSMUSP00000075987

UniGene: Mm.298

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Slc25a3 and what are its primary functions?

Slc25a3 is a multi-pass transmembrane protein located in the mitochondrial inner membrane that belongs to the mitochondrial carrier family (MCF). It serves two critical functions: transporting phosphate from the cytosol into the mitochondrial matrix for oxidative phosphorylation and facilitating copper transport essential for cytochrome c oxidase (COX) assembly. The protein contains six transmembrane segments with a characteristic structure consisting of three repeats of approximately 100 amino acids, each containing two transmembrane helices connected by a loop with a short α-helix . The transmembrane helices feature the conserved PX(D/E)XX(R/K) motif that is a signature of all MCF proteins, which enables the formation of salt bridges that determine substrate specificity and transport directionality .

How do the isoforms of mouse Slc25a3 differ and what is their tissue distribution?

Mouse Slc25a3, like its human ortholog, exists in two isoforms produced through alternative splicing of exon 3:

  • Slc25a3-A: Predominantly expressed in heart and skeletal muscle tissues

  • Slc25a3-B: Expressed in all tissues, including those expressing isoform A

These isoforms differ by 13 amino acids between residues 54 and 80 . Functionally, the B isoform demonstrates approximately 3-fold higher phosphate transport activity compared to the A isoform when reconstituted in liposomes . This tissue-specific expression pattern is conserved between mouse and human, suggesting distinct physiological requirements in different tissues, particularly in high-energy-demanding tissues like cardiac and skeletal muscle .

What experimental models are available for studying Slc25a3?

Several experimental systems are available for investigating Slc25a3 function:

  • Mouse embryonic fibroblast (MEF) models: Immortalized MEF lines with floxed exons 1 and 2 of Slc25a3 (Slc25a3 FLOX) can be treated with Cre recombinase to generate Slc25a3-/- cell lines . These paired isogenic cell lines provide an excellent system for studying loss-of-function effects.

  • Heterologous expression systems:

    • Yeast models: Expression of mouse Slc25a3 cDNA in Saccharomyces cerevisiae pic2Δ strains to assess complementation of copper transport defects

    • Lactococcus lactis: Heterologous expression for measuring transport activity

  • Liposome reconstitution: Purified recombinant Slc25a3 can be reconstituted into liposomes to directly measure transport kinetics for both phosphate and copper .

  • siRNA knockdown models: Human and mouse cell lines can be subjected to transient Slc25a3 knockdown using specific siRNA oligonucleotides to study partial loss of function .

How can I validate successful knockdown or knockout of Slc25a3?

Validation of Slc25a3 depletion should employ multiple approaches:

  • PCR verification: Use PCR to confirm the deletion of floxed exons in Cre-treated cells .

  • Western blotting: Use specific antibodies against Slc25a3. Published studies have utilized rabbit polyclonal antibodies raised against the KLH-conjugated Slc25a3 peptide CRMQVDPQKYKGIFNGSVTLKED (Pacific Immunology) . Commercial antibodies may have variable quality, so validation is essential.

  • Functional assays:

    • Measure COX activity, which is reduced in Slc25a3-deficient cells

    • Assess levels of COX subunits (particularly COX1 and COX4) by immunoblotting

    • Monitor mitochondrial copper levels using copper-specific fluorescent probes like Mito-CS1

  • Controls: Include rescue experiments by reintroducing Slc25a3 cDNA (particularly the B isoform) via retroviral expression to confirm specificity of observed phenotypes .

What methodologies can differentiate between Slc25a3's roles in phosphate versus copper transport?

To distinguish between these dual functions, researchers can employ several complementary approaches:

  • Specific rescue experiments:

    • Copper supplementation: Adding copper bound to an ionophore (CuATSM) that freely crosses biological membranes can rescue COX deficiency in Slc25a3-deficient cells if the primary defect is in copper transport .

    • Phosphate supplementation: Adding phosphate to the culture medium does not rescue COX defects in Slc25a3-deficient cells, suggesting that copper transport is the limiting factor for COX assembly .

  • In vitro transport assays:

    • Reconstituted liposome systems with purified Slc25a3 can directly measure transport of copper and phosphate separately.

    • Comparing kinetic parameters (Km and Vmax) for both substrates under various conditions can reveal substrate preferences and potential competition.

    • Metal specificity tests: Slc25a3 shows specificity for copper, with no significant transport of other tested metals (calcium, zinc, magnesium, and iron) .

  • Mitochondrial copper pool assessment:

    • Fluorescent probes specific for mitochondrial copper (e.g., Mito-CS1) can quantify changes in the mitochondrial copper pool in Slc25a3-deficient cells .

    • ICP-MS (Inductively Coupled Plasma Mass Spectrometry) analysis of isolated mitochondria can provide quantitative measurements of total mitochondrial copper content.

How does deletion of Slc25a3 affect mitochondrial function in mouse embryonic fibroblasts?

Deletion of Slc25a3 in MEFs produces several specific phenotypes that highlight its importance in mitochondrial function:

  • Respiratory chain defects:

    • Decreased levels of COX subunits 1 and 4 observed by immunoblot analysis

    • Reduced COX enzyme activity as measured by spectrophotometric assays

    • Isolated COX deficiency with normal activity of other respiratory chain complexes

  • Copper homeostasis disruption:

    • Reduced mitochondrial copper pool as detected by the copper-specific probe Mito-CS1

    • Defects are rescued by copper supplementation (CuATSM) or re-expression of Slc25a3-B cDNA

  • Preserved mitochondrial integrity:

    • Normal mitochondrial membrane potential (assessed by JC-1 staining)

    • Equivalent mitochondrial content between Slc25a3-/- and Slc25a3 FLOX MEFs (assessed by TOM40 levels and MitoTracker Green staining)

It's important to note that severe (>85%) depletion of Slc25a3 is required to substantially affect oxidative phosphorylation . This indicates a threshold effect where residual Slc25a3 activity can maintain adequate phosphate transport for basic mitochondrial function.

What are the kinetic properties of recombinant Slc25a3 transport activity?

Recombinant Slc25a3 has been purified and reconstituted into liposomes to directly assess its transport properties. Key findings include:

  • Copper transport kinetics:

    • Apparent transport affinity (Km) for copper: approximately 15 μM

    • Specific activity: approximately 25 mmol of copper/min/g protein under standard conditions

    • Transport occurs without internal counter substrates, suggesting unidirectional transport

  • Metal specificity:

    • Highly specific for copper

    • Does not significantly transport calcium, zinc, magnesium, or iron

    • These metals do not interfere with copper transport even at 10-fold molar excess

  • Isoform differences:

    • Both Slc25a3-A and Slc25a3-B transport copper into liposomes

    • Slc25a3-B demonstrates approximately 3-fold higher phosphate transport activity compared to Slc25a3-A, though specific kinetic parameters for phosphate transport vary depending on experimental conditions

These properties suggest that Slc25a3 functions as a dedicated copper transporter with high specificity, in addition to its established role in phosphate transport.

What evidence supports the evolutionary conservation of Slc25a3 function?

Several lines of evidence demonstrate functional conservation of Slc25a3 across species:

  • Sequence homology:

    • Human SLC25A3 shows 49% identity and 65% similarity with yeast Pic2

    • Human SLC25A3 shows 41% identity and 61% similarity with yeast Mir1

    • Yeast Pic2 and Mir1 show 40% identity and 59% similarity to each other

  • Functional complementation:

    • Human SLC25A3-A cDNA expression in pic2Δ yeast restores mitochondrial copper uptake

    • SLC25A3-A expression rescues COX defects in pic2Δ yeast under copper limitation

    • Mouse Slc25a3-B cDNA rescues COX deficiency when expressed in Slc25a3-/- MEFs

  • Substrate conservation:

    • Both yeast Pic2 and human/mouse SLC25A3 transport copper

    • Both yeast Mir1 and human/mouse SLC25A3 transport phosphate

    • This suggests that while yeast has evolved specialized transporters for each substrate, mammalian SLC25A3 maintains dual substrate specificity

This evolutionary conservation highlights the fundamental importance of these transport functions in mitochondrial bioenergetics across eukaryotic species.

What experimental approaches can be used to express and purify recombinant Slc25a3 for in vitro studies?

Successful expression and purification of functional Slc25a3 requires specific methodological considerations:

  • Expression systems:

    • E. coli expression with His6 tags has been successful for obtaining Slc25a3 protein, though it forms inclusion bodies

    • Lactococcus lactis has been used as an alternative expression system that may provide better membrane insertion

  • Purification strategy:

    • Isolation from inclusion bodies followed by denaturation and refolding

    • Affinity chromatography using His6 tags for initial purification

    • Size exclusion or ion exchange chromatography for further purification

  • Reconstitution into liposomes:

    • This approach has been extensively used for MCF proteins to assess transport activity and substrate specificity

    • Lipid composition can affect transport properties and should be optimized

    • Internal substrate loading can be used to test exchange vs. uniport mechanisms

  • Functional validation:

    • Transport assays using radioactive substrates or fluorescent probes

    • Metal-specific assays for copper transport

    • Phosphate transport measurements using 32P or colorimetric assays

These methodologies have been successfully applied to both SLC25A3-A and SLC25A3-B isoforms, enabling comparative studies of their transport properties.

How do mutations in Slc25a3 relate to human disease and what can mouse models reveal about pathophysiology?

Mutations in human SLC25A3 cause mitochondrial phosphate carrier deficiency (MPCD), a fatal disorder with the following characteristics:

  • Clinical presentation:

    • Lactic acidosis

    • Hypertrophic cardiomyopathy

    • Neonatal hypotonia

    • Death within the first year of life

  • Genetic basis:

    • A homozygous mutation (c.215G>A) in the alternatively spliced exon 3A causes an amino acid replacement (G72E) in the A isoform

    • This affects tissues that predominantly express the A isoform (heart and skeletal muscle) while sparing tissues that rely on the B isoform

  • Insights from mouse models:

    • Deletion of Slc25a3 in mouse embryonic fibroblasts results in:

      • COX deficiency

      • Reduced mitochondrial copper levels

      • Rescue by copper supplementation, suggesting a potential therapeutic approach

    • These models provide insight into the molecular mechanisms underlying MPCD and potential therapeutic targets

  • Therapeutic implications:

    • Copper supplementation ameliorates COX defects in Slc25a3-deficient cells

    • This suggests that copper delivery strategies might be beneficial for patients with certain types of SLC25A3 mutations, though this would need careful clinical evaluation

Studies of mouse Slc25a3 provide important insights into the potential mechanism of human disease and highlight the differential tissue sensitivity to SLC25A3 mutations based on isoform expression patterns.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.