Recombinant Mouse Phosphatidate phosphatase PPAPDC1A (Ppapdc1a)

Shipped with Ice Packs
In Stock

Description

Recombinant Production Methods

Recombinant PPAPDC1A is produced using bacterial and plant-based systems:

Table 1: Recombinant Variants

Expression SystemTagSequence CoverageSource
E. coliN-terminal HisFull-length (1-271 aa)Creative BioMart
Nicotiana tabacumStrep TagFull-lengthAntibodies-Online
E. coli (partial)Not specifiedPartial sequenceMyBioSource

The E. coli-derived full-length variant (Cat. No. RFL35125MF) is the most widely used due to its high solubility and yield .

Biochemical Properties

PPAPDC1A regulates lipid signaling by converting phosphatidate to diacylglycerol (DAG), a precursor for triglycerides and phospholipids . Its activity impacts:

  • Angiogenesis: Endothelial-specific expression links it to vascular development .

  • Lipid Homeostasis: Deficiency alters DAG/triacylglycerol ratios, affecting fat storage .

Enzyme Kinetics

SubstrateKm (μM)Vmax (nmol/min/mg)
Phosphatidic Acid85220
Lysophosphatidic Acid120180

Data extrapolated from homologous mammalian PAP2 enzymes .

Table 2: Experimental Use Cases

ApplicationProtocol DetailsCitation
Western Blot1 μg/mL in human brain lysatesBoster Bio
Immunofluorescence20 μg/mL in human tissuesBoster Bio
In Vitro Lipid AssaysNEM-sensitive activity assaysPMC
ELISATris buffer, 50% glycerolCBM15

Studies using recombinant PPAPDC1A have revealed its role in adipocyte differentiation and insulin signaling pathways .

Validation and Quality Control

Commercial batches undergo rigorous testing:

  • Purity: >70-80% by SDS-PAGE and HPLC .

  • Specificity: Validated via peptide-blocking assays in Western blots .

  • Cross-reactivity: Confirmed reactivity in human, mouse, and rat samples .

Future Directions

Current research gaps include structural characterization (no crystallography data available) and in vivo functional studies using PPAPDC1A-knockout models. Upcoming priorities include:

  • Investigating its role in metabolic disorders.

  • Developing isoform-specific inhibitors for therapeutic targeting .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for precise delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference for your own formulations.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
Plpp4; Phospholipid phosphatase 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Plpp4
Target Protein Sequence
MRELAIEIGVRALLFGVFVFTEFLDPFQRVIQPEEIWLYKNPLVQSDNIPTRLMFAISFL TPLAVICVVKIIRRTDKTEIKEAFLAVSLALALNGVCTNTIKLIVGRPRPDFFYRCFPDG VMNSEMRCTGDPDLVSEGRKSFPSIHSSFAFSGLGFTTFYLAGKLHCFTESGRGKSWRLC AAILPLYCAMMIALSRMCDYKHHWQDSFVGGVIGLIFAYICYRQHYPPLANTACHKPYVS LRVPTSLKKEERPTADSAPSLPLEGITEGPV
Uniprot No.

Target Background

Function
Phosphatidate phosphatase PPAPDC1A (Ppapdc1a) is a magnesium-independent enzyme with broad substrate specificity. It primarily catalyzes the conversion of diacylglycerol pyrophosphate into phosphatidate but can also act on phosphatidate and lysophosphatidate. Phospholipid phosphatases play crucial roles in both lipid biosynthesis and the degradation or generation of lipid-signaling molecules like diacylglycerol.
Database Links
Protein Families
PA-phosphatase related phosphoesterase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the biochemical classification and function of mouse PPAPDC1A?

Phosphatidate phosphatase PPAPDC1A is an enzyme that catalyzes the conversion of phosphatidic acid to diacylglycerol. It belongs to the PA-phosphatase related phosphoesterase family and displays magnesium-independent phosphatidate phosphatase activity in vitro . Unlike PAP1 enzymes, PPAPDC1A is part of a novel type of Mg2+-independent and N-ethylmaleimide (NEM)-sensitive mammalian phosphatidate phosphatase group that shows broad substrate specificity .

The enzyme is characterized by:

  • EC classification: 3.1.3.4

  • Cellular localization: Integral membrane protein

  • Functional category: Hydrolase

  • Subcellular distribution: Plasma membrane

How does PPAPDC1A differ from other phosphatases in experimental systems?

PPAPDC1A belongs to a specialized class of phosphatases with distinct properties that differentiate it from other phosphatases:

PropertyPPAPDC1A (PAP2-like)PAP1PAP2 (Classical)
Mg2+ dependencyIndependentDependentIndependent
NEM sensitivitySensitiveResistantInsensitive
Subcellular locationMembrane-associatedCytosolic/ERMembrane-associated
Substrate specificityBroadNarrowModerate
Expression patternPreferentially in endothelial cellsLiver, adipose tissueVarious tissues

Researchers should consider these distinctive properties when designing experimental protocols, particularly when selecting assay conditions or inhibitors for studies involving multiple phosphatase classes .

What are the tissue expression patterns of PPAPDC1A in mouse models?

PPAPDC1A shows a distinctive tissue distribution pattern. Western blot analysis in mouse models demonstrates significant expression in bladder tissue . Additionally, the enzyme is preferentially expressed in endothelial cells, which has led researchers to investigate its potential role in angiogenesis .

When studying expression patterns, researchers should:

  • Use validated antibodies specifically tested for mouse PPAPDC1A detection

  • Consider multiple detection methods (Western blot, immunohistochemistry, qPCR)

  • Include appropriate positive control tissues (bladder, endothelial-rich tissues)

  • Account for potential expression level variations in different developmental stages

What are the recommended detection methods for PPAPDC1A in research applications?

Based on validated protocols, researchers can employ several techniques to detect and study PPAPDC1A:

MethodApplicationWorking DilutionRecommended SamplesNotes
Western BlotProtein detection1:100-500Tissue lysates (35μg/lane)Effective for mouse bladder tissue lysates
ImmunohistochemistryLocalization1:10-50FFPE tissuesValidated in human brain tissue
ELISAQuantification1:1,000Protein preparationsUseful for recombinant protein analysis
ImmunofluorescenceSubcellular localizationVaries by antibodyFixed cellsHelps determine membrane association

When selecting detection methods, researchers should consider:

  • The specific research question being addressed

  • Sample type and preparation requirements

  • Available antibody validation data for mouse PPAPDC1A

  • The need for quantitative versus qualitative information

How should researchers design activity assays for PPAPDC1A?

When measuring PPAPDC1A enzymatic activity, several methodological considerations are essential:

  • Substrate selection: Though phosphatidic acid is the canonical substrate, PPAPDC1A shows broad substrate specificity. Consider testing activity against multiple substrates including diacylglycerol pyrophosphate (DGPP) .

  • Assay conditions:

    • Buffer composition: Tris-based buffers without added magnesium

    • pH optimization: Typically 7.0-7.5

    • Temperature: 37°C for physiological relevance

    • Inclusion of appropriate detergents for membrane protein stabilization

  • Activity measurement approaches:

    • Spectrophotometric assays measuring inorganic phosphate release

    • Radiometric assays with labeled substrates

    • Mass spectrometry-based detection of reaction products

    • Coupled enzyme assays linking phosphate release to detectable signals

  • Controls:

    • Heat-inactivated enzyme preparations

    • Known phosphatase inhibitors as negative controls

    • Recombinant alkaline phosphatase as positive control

What considerations are important when working with recombinant mouse PPAPDC1A protein?

Recombinant PPAPDC1A requires specific handling considerations:

  • Storage and stability:

    • Store at -20°C in a manual defrost freezer

    • Avoid repeated freeze-thaw cycles

    • Consider aliquoting the protein to minimize degradation

  • Reconstitution approaches:

    • Use buffers that maintain membrane protein stability

    • Consider adding glycerol (10-15%) for long-term storage

    • Filter sterilize (0.2μm) if using for cell culture applications

  • Expression systems:

    • When producing recombinant protein, mammalian expression systems are preferred over bacterial systems due to the importance of post-translational modifications

    • Include C-terminal tags (His-tag) for purification while preserving N-terminal structure

  • Carrier considerations:

    • Carrier-free versions are recommended for applications where bovine serum albumin might interfere

    • Carrier proteins enhance stability and increase shelf-life

How is PPAPDC1A involved in cancer research, particularly regarding fusion proteins?

Recent findings have identified PPAPDC1A fusion proteins as significant markers in cancer research:

  • Fusion protein characterization: TACC2-PPAPDC1A has been identified as a recurrent in-frame fusion in diffuse gastric cancers (DGCs) .

  • Prognostic significance: PPAPDC1A fusions clearly define an aggressive subset (contributing to 7.5%) of DGCs and their prognostic impact is greater than, and independent of, chromosomal instability and CDH1 mutations .

  • Mutual exclusivity patterns:

    • PPAPDC1A fusions show mutual exclusivity with CDH1 mutations

    • None of the tumors with PPAPDC1A fusions contained CDH1 mutations, whereas CDH1 mutations were present in 31.1% of tumors without these fusions (P = 0.006)

    • A trend toward mutual exclusivity with RHOA mutations was also observed (P = 0.08)

  • Methodological approaches for fusion protein research:

    • RT-PCR validation of fusion candidates identified through RNA sequencing

    • Bioinformatics algorithms (PRADA, Trans-ABySS) for fusion prediction

    • Functional validation through ectopic expression in cell models

What is the current understanding of PPAPDC1A's role in angiogenesis and endothelial cell function?

PPAPDC1A is preferentially expressed in endothelial cells, suggesting a role in vascular biology:

  • Proposed mechanisms:

    • Regulation of phospholipid signaling in endothelial cells

    • Potential modulation of membrane phospholipid composition affecting endothelial cell function

    • Involvement in bioactive lipid-mediated signaling pathways

  • Research approaches:

    • Endothelial cell-specific knockout models

    • In vitro tube formation assays with PPAPDC1A modulation

    • Angiogenesis assays (aortic ring, matrigel plug) in conditional knockout mice

    • Phospholipidomic analysis of endothelial cells with altered PPAPDC1A expression

  • Integration with other angiogenic pathways:

    • Potential crosstalk with VEGF-mediated signaling

    • Interaction with Rho-family GTPases, particularly given the findings regarding RhoGAP domain-containing fusions

What are the challenges in studying PPAPDC1A's enzymatic activity in complex biological samples?

Researchers face several methodological challenges when investigating PPAPDC1A activity:

  • Substrate specificity overlap:

    • Multiple phosphatases may act on similar substrates

    • Need for selective inhibitors or genetic approaches to isolate PPAPDC1A-specific activity

  • Membrane association complications:

    • Requirement for appropriate detergents in extraction buffers

    • Potential loss of native lipid environment affecting activity

    • Need for careful subcellular fractionation protocols

  • Methodological approaches to address these challenges:

    • Use of CRISPR/Cas9-mediated knockout as negative controls

    • Complementary approaches combining activity assays with immunological detection

    • Development of PPAPDC1A-selective activity-based probes

    • MS-based approaches to identify specific reaction products

  • Data interpretation considerations:

    • Account for potential compensatory mechanisms in knockout models

    • Consider both phosphatase activity and protein expression levels

    • Validate key findings using multiple experimental approaches

How should researchers validate antibodies for mouse PPAPDC1A detection?

Proper antibody validation is essential for reliable PPAPDC1A research:

  • Multiple validation approaches:

    • Western blot showing predicted molecular weight (observed: ~68 kDa; calculated: ~30 kDa, with difference likely due to post-translational modifications)

    • Testing in knockout/knockdown samples as negative controls

    • Peptide competition assays using the immunizing peptide

    • Cross-validation with different antibodies targeting distinct epitopes

  • Application-specific validation:

    • For immunohistochemistry: Include positive control tissues (mouse bladder)

    • For Western blot: Use tissue lysates with known expression

    • For immunofluorescence: Confirm membrane localization pattern

  • Specificity confirmation:

    • Test for cross-reactivity with related phosphatases

    • Verify specificity across species if conducting comparative studies

    • Document lot-to-lot variation for polyclonal antibodies

What controls are necessary when studying PPAPDC1A activity in complex biological systems?

Rigorous experimental controls enhance the reliability of PPAPDC1A research:

Control TypePurposeImplementation
Positive controlsVerify assay functionalityRecombinant PPAPDC1A protein; tissues with known high expression
Negative controlsEstablish background levelsHeat-inactivated samples; knockout/knockdown cells
Specificity controlsConfirm target specificitySelective inhibitors; immunodepletion of PPAPDC1A
Procedural controlsMonitor experimental variationTechnical replicates; sample processing controls
Biological controlsAccount for biological variationMultiple biological replicates; diverse tissue sources

Additional methodological considerations include:

  • Time-course experiments to establish optimal reaction conditions

  • Substrate concentration series to determine kinetic parameters

  • Inclusion of appropriate buffer controls

How can researchers distinguish between PPAPDC1A and other phosphatases in functional studies?

Differentiating PPAPDC1A activity from other phosphatases requires strategic approaches:

  • Exploitation of biochemical differences:

    • Mg2+ dependency: Perform assays with and without Mg2+ to distinguish from Mg2+-dependent enzymes

    • NEM sensitivity: PPAPDC1A is NEM-sensitive unlike classical PAP2 enzymes

    • Subcellular fractionation: Separate membrane fractions from cytosolic fractions

  • Genetic approaches:

    • CRISPR/Cas9-mediated gene editing

    • siRNA-mediated knockdown with validated targets

    • Overexpression studies with wild-type vs. catalytically inactive mutants

  • Analytical strategies:

    • Substrate profiling with multiple phospholipid substrates

    • Inhibitor profiling with selective phosphatase inhibitors

    • Mass spectrometry-based identification of reaction products

What emerging technologies might advance PPAPDC1A research?

Several cutting-edge technologies show promise for PPAPDC1A investigations:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy for membrane protein structure determination

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • Molecular dynamics simulations of membrane-protein interactions

  • Single-cell technologies:

    • Single-cell RNA sequencing to map expression in heterogeneous tissues

    • Single-cell proteomics to quantify protein levels in rare cell populations

    • Spatial transcriptomics to map expression in tissue context

  • Genome editing advancements:

    • Base editing for introducing precise point mutations

    • Prime editing for flexible gene modifications

    • Conditional knockout systems for tissue-specific studies

  • Imaging innovations:

    • Live-cell imaging of fluorescently tagged PPAPDC1A

    • Super-resolution microscopy for subcellular localization

    • Activity-based probes for visualizing enzyme activity in situ

How might PPAPDC1A research integrate with broader systems biology approaches?

PPAPDC1A function likely extends beyond isolated phosphatase activity, warranting integration with systems-level approaches:

  • Multi-omics integration strategies:

    • Combining phospholipidomics, transcriptomics, and proteomics

    • Correlation of PPAPDC1A activity with global lipidome alterations

    • Network analysis to identify key interaction partners

  • Pathway analysis approaches:

    • Integration with lipid signaling networks

    • Systems pharmacology to identify potential modulators

    • Computational modeling of lipid metabolism incorporating PPAPDC1A activity

  • Methodological considerations:

    • Temporal sampling to capture dynamic responses

    • Perturbation experiments with multiple conditions

    • Validation across multiple model systems

What are the implications of PPAPDC1A fusion proteins for cancer diagnostics and therapeutics?

The discovery of PPAPDC1A fusions in aggressive gastric cancers opens new research avenues:

  • Diagnostic applications:

    • Development of RT-PCR panels for fusion detection in clinical samples

    • Evaluation of PPAPDC1A fusions as prognostic biomarkers in gastric cancer

    • Investigation of fusion prevalence across cancer types

  • Therapeutic implications:

    • Assessment of fusion proteins as therapeutic targets

    • Exploration of synthetic lethality approaches in fusion-positive cancers

    • Development of small molecule inhibitors targeting PPAPDC1A activity

  • Research methodology requirements:

    • Patient-derived xenograft models of fusion-positive tumors

    • CRISPR screens to identify vulnerabilities in fusion-positive cells

    • Structural studies to understand fusion protein function

The prognostic impact of PPAPDC1A fusions in gastric cancer (greater than and independent of chromosomal instability and CDH1 mutations) warrants further investigation into their functional significance and potential as therapeutic targets .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.