Recombinant Mouse Phosphatidate phosphatase PPAPDC1B (Ppapdc1b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Plpp5; Phospholipid phosphatase 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-260
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Plpp5
Target Protein Sequence
MGTAALGAELGVRVLLFVAFLVTELLPPFQRRIQPEELWLYRNPYVEAEYFPTGRMFVIA FLTPLSLIFLAKFLRKADATDSKQACLAASLALALNGVFTNIIKLIVGRPRPDFFYRCFP DGLAHSDLTCTGDEDVVNEGRKSFPSGHSSFAFAGLAFASFYLAGKLHCFTPQGRGKSWR LCAFLSPLLFAAVIALSRTCDYKHHWQDVLVGSMIGMTFAYVCYRQYYPPLTDVECHKPF QDKHKLPSSQKPSELHHLEI
Uniprot No.

Target Background

Function
Recombinant Mouse Phosphatidate phosphatase PPAPDC1B (Ppapdc1b) is a magnesium-independent phospholipid phosphatase with broad substrate specificity. It preferentially catalyzes the conversion of diacylglycerol pyrophosphate to phosphatidate but can also act on phosphatidate and lysophosphatidate. Phospholipid phosphatases play crucial roles in lipid synthesis and the generation or degradation of lipid signaling molecules.
Database Links
Protein Families
PA-phosphatase related phosphoesterase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Specifically expressed by antibody-secreting immune cells.

Q&A

What is mouse Ppapdc1b and what are its primary biological functions?

Ppapdc1b (also known as PLPP5) is a phosphatidate phosphatase that plays important roles in lipid-signaling metabolism in eukaryotic cells. It functions as a Mg2+-independent and NEM-sensitive phosphatase with broad substrate specificity. Ppapdc1b preferentially catalyzes the conversion of diacylglycerol pyrophosphate into phosphatidate but can also act on phosphatidate and lysophosphatidate . Beyond its enzymatic functions, Ppapdc1b is involved with multiple cell signaling pathways, including JAK-Stat3, MAP kinase, and PKC pathways . Research has also demonstrated that it may potentiate the estrogen receptor pathway by down-regulating DUSP22 . This multifunctional role positions Ppapdc1b as a significant protein at the intersection of lipid metabolism and cellular signaling.

What nomenclature and aliases are associated with mouse Ppapdc1b in scientific literature?

Researchers should be aware of several alternative designations when searching literature related to this protein:

  • PLPP5 (Phospholipid Phosphatase 5) - current HGNC-approved name

  • PPAPDC1B - previous designation

  • DPPL1 (Diacylglycerol pyrophosphate like 1)

  • HTPAP

  • Phosphatidic acid phosphatase type 2 domain containing 1B

The human ortholog is designated by UniProt ID Q8NEB5, and the gene ID is 84513 . Understanding these various nomenclatures is essential for comprehensive literature reviews and database searches.

How does mouse Ppapdc1b differ from other phosphatidate phosphatases in terms of biochemical properties?

Phosphatidate phosphatases can be distinguished based on their subcellular localization and differential sensitivity to inhibitors. Ppapdc1b belongs to a novel type of phosphatidate phosphatase that is Mg2+-independent (unlike PAP1) but NEM-sensitive (unlike PAP2/DPP1) . This unique biochemical signature places it in a distinct category compared to other phosphatidate phosphatases. While PAP2/DPP1 enzymes are also Mg2+-independent, they differ from Ppapdc1b in being NEM-insensitive . These distinctive properties should be considered when designing enzymatic assays or when interpreting experimental results involving phospholipid metabolism.

What expression systems are optimal for producing functional recombinant mouse Ppapdc1b?

Based on protocols for similar proteins, bacterial expression systems utilizing E. coli BL21(DE3) strains can be employed for recombinant Ppapdc1b production . For optimal expression, consider the following parameters:

ParameterRecommended ConditionJustification
Culture MediumTB (Terrific Broth)Provides superior biomass and protein yield
Induction Temperature15°CLower temperatures reduce aggregation
IPTG Concentration0.25 mMLower concentrations favor proper folding
Induction Duration24 hoursExtended time compensates for lower temperature

Due to Ppapdc1b's transmembrane nature, researchers might also consider eukaryotic expression systems for studies requiring post-translational modifications or proper membrane insertion .

What purification strategies yield highest purity and functional activity for recombinant Ppapdc1b?

While specific purification protocols for mouse Ppapdc1b are not directly described in the literature, effective strategies for similar membrane-associated proteins suggest using detergent-containing buffers during purification. A buffer containing approximately 2% sarkosyl has been shown to produce higher yield and purity for other challenging proteins . For affinity purification, recombinant constructs with N-terminal His-tags (typically 6x or 10x His) facilitate isolation via nickel affinity chromatography . When designing a purification protocol, researchers should carefully validate that the purified protein retains enzymatic activity, particularly considering Ppapdc1b's role in phospholipid metabolism.

What functional assays can verify the biochemical activity of purified recombinant Ppapdc1b?

To verify functional activity of recombinant Ppapdc1b, researchers should design assays that measure its phosphatase activity against preferred substrates. As Ppapdc1b preferentially catalyzes the conversion of diacylglycerol pyrophosphate into phosphatidate , this reaction should serve as the primary readout for activity confirmation. Critical considerations for functional assay design include:

  • Assay buffers should not contain Mg2+ as a requirement, as Ppapdc1b functions independently of this cation

  • NEM sensitivity can be used as a control parameter

  • Secondary substrates (phosphatidate and lysophosphatidate) can be employed in comparative assays

  • Western blotting using specific antibodies can confirm protein identity and integrity

How is PPAPDC1B implicated in tumorigenesis, particularly in the context of the 8p11-12 amplicon?

PPAPDC1B has emerged as an important driver gene in the 8p11-12 chromosomal amplification, which is a common genetic event occurring in 10-15% of breast carcinomas . Genomic studies have consistently identified PPAPDC1B as one of the genes within this region that is both amplified and overexpressed in cancer cells . Comparative genomic hybridization arrays and expression profiling analyses of 152 ductal breast carcinomas and 21 cell lines confirmed that PPAPDC1B is consistently overexpressed due to increased gene copy number . This amplification pattern strongly suggests PPAPDC1B functions as an oncogene in breast cancer and potentially other cancer types, positioning it as a valuable subject for cancer biology research.

What experimental approaches have been successful in investigating PPAPDC1B's role in cancer progression?

Several methodologies have proven effective for studying PPAPDC1B in cancer models:

  • RNA interference approaches: Both siRNA and shRNA-mediated knockdown experiments have demonstrated the functional significance of PPAPDC1B. These studies revealed that PPAPDC1B plays a major role in regulating the survival and transformation of cancer cell lines harboring the 8p amplicon .

  • Xenograft models: In vivo studies showed that silencing PPAPDC1B strongly inhibits the growth of breast tumor xenografts displaying 8p11-12 amplification, further validating its role in tumor development .

  • Comparative functional studies: Research comparing PPAPDC1B with other amplified genes like WHSC1L1 found that PPAPDC1B knockdown had a greater effect on cloning efficiency, highlighting its particularly important role in cellular transformation .

  • Gene expression analysis: Quantitative RT-PCR experiments following PPAPDC1B knockdown revealed distinctive gene targets in different cancer types .

What are the methodological challenges in distinguishing between PPAPDC1B's enzymatic functions and its signaling pathway interactions?

Disentangling PPAPDC1B's dual roles in lipid metabolism and signaling presents significant experimental challenges. Researchers should consider implementing:

  • Catalytically inactive mutants: Generating point mutations in the phosphatase domain that preserve protein structure but eliminate enzymatic activity can help differentiate between enzymatic and scaffolding functions.

  • Domain-specific interaction studies: As PPAPDC1B interacts with multiple signaling pathways (JAK-Stat3, MAP kinase, PKC) , researchers should employ co-immunoprecipitation and proximity labeling techniques to identify direct protein interaction partners.

  • Lipidomic profiling: Quantitative lipidomics before and after PPAPDC1B modulation can reveal changes in cellular lipid composition resulting from its enzymatic activity.

  • Pathway-specific readouts: When investigating PPAPDC1B's role in particular signaling pathways, researchers should employ multiple independent readouts for each pathway to confirm specific effects.

What considerations are important when translating findings from mouse Ppapdc1b studies to human applications?

While mouse models provide valuable insights, translational research requires careful consideration of species differences:

What emerging technologies might advance our understanding of PPAPDC1B biology?

Future research on PPAPDC1B might benefit from several cutting-edge approaches:

  • CRISPR-based genetic screens: Genome-wide or targeted CRISPR screens could identify synthetic lethal interactions with PPAPDC1B amplification, revealing potential combination therapy approaches.

  • Structure-function studies: Crystal structure determination of PPAPDC1B would facilitate rational design of specific inhibitors targeting its phosphatase domain.

  • Single-cell multi-omics: Combining single-cell transcriptomics with proteomics or metabolomics could reveal cell-type specific roles of PPAPDC1B in heterogeneous tumor environments.

  • Patient-derived organoids: Testing PPAPDC1B modulation in 3D organoid cultures derived from tumors with 8p11-12 amplification could provide more physiologically relevant insights than traditional cell line models.

What are the optimal antibodies and detection methods for studying mouse Ppapdc1b in various experimental contexts?

Commercially available polyclonal antibodies against PPAPDC1B can be used for detection in various applications. For example, Thermofisher offers a polyclonal antibody (PA5-65973) raised against the immunogen sequence "QRLIQPEEMWL YRNPYVEAEY F" that shows 91% identity to the mouse ortholog . When selecting antibodies for mouse Ppapdc1b studies, researchers should:

  • Validate antibody specificity using positive controls (overexpression systems) and negative controls (knockdown/knockout samples)

  • Determine optimal antibody concentrations for each application (Western blot, immunohistochemistry, flow cytometry)

  • Consider using multiple antibodies targeting different epitopes to confirm findings

  • For recombinant proteins with affinity tags, employ tag-specific antibodies as complementary detection methods

How can researchers effectively measure changes in Ppapdc1b expression levels following experimental manipulations?

Multiple complementary approaches can be employed to accurately quantify changes in Ppapdc1b expression:

  • Quantitative RT-PCR: Design primers specific to mouse Ppapdc1b, considering potential splice variants

  • Western blotting: Use validated antibodies with appropriate loading controls

  • ELISA assays: Can provide more quantitative measures of protein levels than Western blotting

  • Mass spectrometry: For unbiased proteomic quantification

When knocking down Ppapdc1b expression using siRNA or shRNA approaches, researchers should confirm efficiency at both mRNA and protein levels, as demonstrated in previous studies investigating PPAPDC1B's role in cancer cell lines .

Table 1: Comparison of Key Features of PPAPDC1B and Related Phosphatases

CharacteristicPPAPDC1B/PLPP5PAP1PAP2/DPP1
Mg2+ DependencyIndependentDependentIndependent
NEM SensitivitySensitive-Insensitive
Subcellular LocalizationMembrane-associated-Membrane-associated
Substrate PreferenceDGPP → PA-DGPP
Signaling Pathway InvolvementJAK-Stat3, MAP kinase, PKC--
Role in 8p11-12 AmpliconMajor driver geneNot implicatedNot implicated

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.