Recombinant Mouse Phosphatidylinositide phosphatase SAC1 (Sacm1l)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
Sacm1l; Kiaa0851; Sac1; Phosphatidylinositol-3-phosphatase SAC1; Phosphatidylinositol-4-phosphate phosphatase; Suppressor of actin mutations 1-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-587
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MAAAAYEHLKLHITPEKFYVEACDDGADDVLIIDRVSTEVTLAVKKDVPPSAVTRPIFGI LGTIHLVAGNYLVVITKKMKVGECFNHAVWRATDFDVLSYKKTMLHLTDIQLQDNKTFLA MLNHVLSMDGFYFSTTYDLTHTLQRLSNTSPEFQEMSLLERADQRFVWNGHLLRELSAQP EVHRFALPVLHGFITMHSCSINGKYFDWILISRRSCFRAGVRYYVRGIDSEGHAANFVET EQIVHYSGNRASFVQTRGSIPIFWSQRPNLKYKPHPQISKVANHMDGFQRHFDSQVIIYG KQVIINLVNHKGSEKPLEQTFANMVSSLGSGMIRYIAFDFHKECKNMRWDRLSILLDQVA EMQDELSYFLVDSAGKVVTNQDGVFRSNCMDCLDRTNVIQSLLARRSLQAQLQRLGVLHV GQKLEEQDEFEKTYKNAWADNANACAKQYAGTGALKTDFTRTGKRTQLGLLMDGFNSLLR YYKNNFSDGFRQDSIDLFLGNYSVDELESHSPLSVPRDWKFLALPIIMVVAFSMCIICLL MAGDTWTETLAYVLFWGVASIGTFFIILYNGKDFVDAPRLVQKEKID
Uniprot No.

Target Background

Function
Phosphatidylinositol phosphatase SAC1 (Sacm1l) catalyzes the hydrolysis of phosphatidylinositol 4-phosphate (PtdIns(4)P) and phosphatidylinositol 3-phosphate (PtdIns(3)P). It exhibits low activity towards phosphatidylinositol-3,5-bisphosphate (PtdIns(3,5)P2). Robust PtdIns(4)P phosphatase activity is observed when binding PtdIns(4)P in a 'cis' configuration within the cellular environment, with significantly reduced activity in a 'trans' configuration. PtdIns(4)P phosphatase activity (in the 'trans' configuration) is enhanced by PLEKHA3.
Gene References Into Functions
  1. These findings indicate direct roles for p38 MAPK and SAC1 in transmitting growth signals to the secretory pathway. PMID: 18299350
  2. SAC1 plays a crucial role in mammalian cellular function, impacting both Golgi membrane organization and mitotic spindle formation. PMID: 18480408
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in brain, lung, liver and kidney, and at lower levels in spleen and skeletal muscle.

Q&A

What is SACM1L and what are its primary cellular functions?

SACM1L (SAC1 like phosphatidylinositide phosphatase, also known as SAC1) is an integral membrane protein primarily localized to the endoplasmic reticulum (ER) and Golgi apparatus. It functions as a phosphoinositide phosphatase that catalyzes the hydrolysis of several phosphatidylinositol species, including phosphatidylinositol 4-phosphate (PtdIns4P), phosphatidylinositol 3-phosphate (PtdIns3P), and to a lesser extent, phosphatidylinositol 3,5-bisphosphate (PtdIns3,5P2) .

The enzyme plays a critical role in regulating phosphoinositide turnover, which is essential for maintaining membrane identity and function in cellular transport processes . Additionally, SACM1L contributes to the organization of Golgi membranes and mitotic spindles . Research has demonstrated that SACM1L is essential for mammalian development, as deletion of the gene in mice results in preimplantation lethality .

How does SACM1L's enzymatic activity differ in 'cis' versus 'trans' configurations?

SACM1L shows differential phosphatase activity depending on its configuration relative to its lipid substrate. The enzyme exhibits robust PtdIns4P phosphatase activity when it binds PtdIns4P in a 'cis' configuration within the same membrane (e.g., within the ER) . In contrast, SACM1L shows significantly reduced activity when binding PtdIns4P in a 'trans' configuration across different membrane compartments .

Recent research demonstrates that this preference for 'cis' activity supports SACM1L's role in maintaining phosphoinositide gradients between organelle membranes and the ER, which drives counter-transport of other lipids via non-vesicular traffic . Interestingly, the 'trans' activity of SACM1L can be enhanced in the presence of specific interacting proteins such as PLEKHA3 . This configurational preference is biologically significant as it ensures proper spatial regulation of phosphoinositide pools within the cell.

What approaches are most effective for studying SACM1L function in cellular systems?

Several complementary approaches have proven valuable for investigating SACM1L function:

What antibodies and detection methods are recommended for SACM1L analysis?

Commercially available antibodies for SACM1L detection include:

  • Rabbit polyclonal antibodies that have been validated for Western blotting (WB), immunocytochemistry/immunofluorescence (ICC/IF), immunohistochemistry (IHC), immunoprecipitation (IP), and ELISA applications . These antibodies have confirmed reactivity with human, mouse, and rat SACM1L proteins.

  • For immunofluorescence studies, researchers should consider using GFP-tagged SACM1L constructs alongside markers for specific cellular compartments (e.g., iRFP-Sec61β for total ER) to accurately assess localization patterns .

When conducting co-localization studies, particularly at membrane contact sites (MCS), quantitative TIRF microscopy with appropriate controls (including positive controls like GFP-ORP5, GFP-E-Syt2, and MAPPER as well as negative controls like GFP-calreticulin and GFP-Sec61β) provides a rigorous approach to determine the MCS index .

How does SACM1L contribute to phosphoinositide gradients and non-vesicular lipid transport?

SACM1L plays a critical role in establishing and maintaining phosphoinositide gradients between the ER and other organelles, particularly regarding PtdIns4P levels. These gradients are essential drivers of counter-transport of other lipids via non-vesicular traffic mechanisms .

The enzymatic activity of SACM1L primarily operates in a 'cis' configuration, degrading PtdIns4P within the ER membrane . This activity is crucial for maintaining the PtdIns4P gradient that exists between the ER (low PtdIns4P) and other organelles like the Golgi and plasma membrane (high PtdIns4P). When SACM1L is inhibited, PtdIns4P accumulates in the ER, disrupting this gradient .

Research using acute chemical inhibition of SAC1 has demonstrated that this disruption leads to significant alterations in membrane identity and lipid distribution patterns throughout the cell . The resulting changes in membrane composition impact numerous cellular processes, including protein trafficking, organelle structure, and signaling pathway activity.

What is the relationship between SACM1L and membrane contact sites (MCS)?

Although it has been proposed that SACM1L might act in 'trans' at membrane contact sites, research challenges this model. High-resolution imaging studies have demonstrated that SACM1L does not significantly enrich at membrane contact sites between the ER and plasma membrane .

Quantitative co-localization analyses using TIRF microscopy with markers for MCS (mCherry-MAPPER) and total ER (iRFP-Sec61β) revealed that SACM1L exhibits a distribution pattern more similar to general ER proteins rather than MCS-specific proteins . Additionally, attempts to enhance 'trans' activity of SACM1L required the artificial addition of a linker between its ER-anchored and catalytic domains, further suggesting that SACM1L does not naturally function effectively in 'trans' .

This evidence supports an obligate 'cis' model for SACM1L activity, where it primarily degrades PtdIns4P within the ER membrane, rather than reaching across to other membranes at contact sites .

How does SACM1L contribute to cellular defense against bacterial pathogens?

SACM1L plays an essential role in xenophagy, a specialized form of autophagy that targets intracellular pathogens for lysosomal degradation . Recent research using targeted genetic screens against phosphoinositide kinases and phosphatases has identified SACM1L as a crucial regulator of this innate immune process .

Studies using CRISPR knockout cells with subsequent re-expression of either wild-type or catalytically-dead SACM1L have confirmed that the enzymatic activity of SACM1L is specifically required to suppress replication of intracellular bacteria such as Salmonella . The mechanism involves the regulation of PtdIns4P levels on bacteria-containing autophagosomes, which affects their fusion with degradative lysosomes .

When SACM1L is deficient, cells accumulate excess PtdIns4P on bacteria-containing autophagosomes, resulting in delayed fusion with lysosomes and reduced bacterial killing efficiency . This creates a vulnerability that certain pathogens have evolved to exploit.

How do bacterial pathogens exploit SACM1L-dependent processes?

Some bacterial pathogens have evolved mechanisms to interfere with SACM1L-regulated processes to enhance their survival within host cells. For example, Salmonella secretes an effector protein called SteA that specifically binds to PtdIns4P .

Research has demonstrated that SteA exacerbates the SACM1L-dependent delay in autophagosomal maturation, effectively exploiting a vulnerability in the host defense system . This pathogen-host interaction represents a balance where the outcome of infection (bacterial clearance versus proliferation) depends on the specific composition of autophagosomal membranes, which is regulated in part by SACM1L activity .

This finding highlights the importance of phosphoinositide regulation by SACM1L in innate immunity and suggests that enhancing SACM1L activity or bypassing SteA-mediated interference could be potential therapeutic strategies for combating intracellular bacterial infections .

What approaches are most effective for studying the relationship between SACM1L and autophagy?

To investigate SACM1L's role in autophagy and xenophagy, researchers should consider the following methodological approaches:

  • Targeted genetic screens: Using siRNA or CRISPR technology targeting phosphoinositide kinases and phosphatases can identify key regulators of autophagy, as demonstrated by recent studies that identified SACM1L as essential for xenophagy .

  • Rescue experiments: When working with SACM1L knockout models, performing rescue experiments with both wild-type and catalytically inactive mutants helps distinguish between enzymatic and structural roles of the protein .

  • Live confocal imaging: Time-dependent, quantitative imaging of fluorescently labeled autophagy markers in combination with phosphoinositide sensors enables visualization of dynamic processes during autophagosome formation and maturation .

  • Bacterial infection models: Using fluorescently labeled intracellular pathogens like Salmonella provides a functional readout for xenophagy efficiency . Quantification of bacterial replication in different genetic backgrounds offers insights into the importance of specific factors like SACM1L.

  • Membrane composition analysis: Since autophagosomal membrane composition significantly impacts function, analyzing phosphoinositide distribution and dynamics during infection using specific probes is crucial .

What are the technical challenges in working with recombinant SACM1L protein?

Working with recombinant SACM1L presents several technical challenges that researchers should consider:

  • Protein solubility and stability: As an integral membrane protein normally anchored in the ER, full-length SACM1L can be difficult to express and purify in active form. Using partial constructs (such as the T149-G500 region) expressed in E. coli or yeast systems has proven more successful .

  • Maintaining enzymatic activity: Preserving the phosphatase activity during purification requires careful consideration of buffer conditions, as the enzyme is sensitive to oxidation and can be inhibited by oxidizing compounds .

  • Configuration-dependent activity: As SACM1L activity differs dramatically between 'cis' and 'trans' configurations, designing in vitro assays that accurately reflect physiological conditions is challenging . Researchers must consider membrane presentation of substrates rather than simply using soluble substrate analogs.

  • Species differences: While SACM1L is highly conserved across mammals, subtle differences between human and mouse orthologs may impact experimental outcomes, particularly in cross-species complementation studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.