Recombinant Mouse Phosphatidylinositol N-acetylglucosaminyltransferase subunit P (Pigp)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a particular tag, please specify this in your order for preferential development.
Synonyms
Pigp; Dcrc; Dscr5; Phosphatidylinositol N-acetylglucosaminyltransferase subunit P; Down syndrome critical region protein 5 homolog; Phosphatidylinositol-glycan biosynthesis class P protein; PIG-P
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-132
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Pigp
Target Protein Sequence
MVENSPSPLPERAIYGFVLFLSSQFGFILYLVWAFVPESWLNSLGLTYWPQKYWAVALPV YLLITVVIGYVLLFGINMMSTSPLDSIHTITDNYAKNQQRKNYQEDAIPALRDVPISEVN KMFFLGAKELNT
Uniprot No.

Target Background

Function
Recombinant Mouse Phosphatidylinositol N-acetylglucosaminyltransferase subunit P (Pigp) is a component of the glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex. It catalyzes the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, representing the initial step in GPI biosynthesis.
Database Links
Protein Families
PIGP family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in tongue.

Q&A

What is Phosphatidylinositol N-acetylglucosaminyltransferase subunit P (PIGP) and what is its primary function?

Phosphatidylinositol N-acetylglucosaminyltransferase subunit P (PIGP) is an enzyme subunit involved in the first step of glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. Specifically, PIGP is a component of the GPI-N-acetylglucosaminyltransferase complex that catalyzes the transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to phosphatidylinositol (PI) .

Mouse PIGP is encoded by the Pigp gene (Gene ID: 56176), with a UniProt ID of Q9JHG1 . Functionally, it participates in the first and critical step of the GPI-anchor biosynthesis pathway, which is essential for the proper localization of many cell surface proteins. Disruptions in this pathway can lead to various pathological conditions, which makes PIGP an important target for research in cellular biology and disease mechanisms.

What are the best experimental approaches for studying mouse PIGP function in vitro?

To study mouse PIGP function in vitro, researchers should consider multiple complementary approaches:

  • Recombinant Protein Expression Systems:

    • Bacterial expression systems (E. coli) for high yield but may lack post-translational modifications

    • Mammalian expression systems (HEK-293F) for properly folded and modified proteins that retain native activity

    • Cell-free protein synthesis for rapid production without cellular interference

  • Enzymatic Activity Assays:

    • UDP-GlcNAc transferase activity assays using radiolabeled UDP-[³H]GlcNAc and PI substrates

    • Measuring the formation of GlcNAc-PI as the product of the enzymatic reaction

    • Coupling enzymatic reactions to spectrophotometric or fluorescent readouts

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation to identify binding partners within the GPI-GnT complex

    • Proximity labeling techniques (BioID, APEX) to map protein interactions in situ

    • Surface plasmon resonance (SPR) or biolayer interferometry to measure binding kinetics

  • Structural Analysis:

    • X-ray crystallography or cryo-electron microscopy for high-resolution structural information

    • Hydrogen-deuterium exchange mass spectrometry to map protein dynamics and conformational changes

When designing these experiments, researchers should carefully consider the appropriate tags (His, Strep, GST) for purification and detection, as these can influence protein folding and activity. For functional studies, it's often beneficial to use the full GPI-GnT complex rather than isolated PIGP, as the enzyme functions as part of this multiprotein assembly.

How should researchers design ELISA protocols for recombinant mouse PIGP proteins?

When designing ELISA protocols for recombinant mouse PIGP proteins, researchers should consider the following methodological approach:

Protocol Design Considerations:

  • Selection of Appropriate ELISA Format:

    • Sandwich ELISA: Use two antibodies that recognize different epitopes of PIGP

    • Direct ELISA: Immobilize PIGP directly on the plate

    • Competitive ELISA: Useful for quantifying PIGP in complex samples

  • Reagent Preparation:

    • Coating Buffer: Standard range for PIGP ELISAs is typically 0.156 ng/ml - 10 ng/ml

    • Blocking Solution: BSA-free formulations for carrier-free PIGP proteins

    • Storage Conditions: Store lyophilized PIGP at -20°C; avoid repeated freeze-thaw cycles

  • Sensitivity and Specificity Enhancement:

    • Optimal Dilutions: Determine experimentally, but typically start at 1:50-1:200 for antibodies

    • Sample Types: PIGP ELISAs work with tissue homogenates, cell lysates, and other biological fluids

    • Detection Method: Colorimetric detection is standard for PIGP ELISAs

  • Controls and Validation:

    • Include recombinant PIGP protein standards of known concentration

    • Use negative controls lacking primary antibody

    • Evaluate cross-reactivity with related proteins (e.g., other PIG family proteins)

Table 1: Recommended ELISA Conditions for Mouse PIGP Detection

ParameterRecommendationNotes
Coating Concentration0.1-1.0 μg/mlOptimize based on antibody affinity
Blocking Solution1-5% BSA or non-fat milkBSA preferred for phosphoprotein detection
Sample DilutionStart with 1:2, 1:5, 1:10Optimize based on PIGP concentration
Antibody DilutionPrimary: 1:500-1:2000; Secondary: 1:1000-1:5000Titrate for optimal signal-to-noise ratio
Incubation Temperature4°C overnight for coating; RT for other stepsLonger incubations may increase sensitivity
Detection SubstrateTMB for HRP; pNPP for APChoose based on conjugated enzyme
Test Range0.156 ng/ml - 10 ng/mlStandard curve should cover this range

Note that the recombinant mouse PIGP protein may require carrier-free versions for certain applications where BSA might interfere . Always validate the ELISA with known positive and negative samples before proceeding with experimental samples.

How can CRISPR-Cas9 gene editing be optimized for studying PIGP function in mouse models?

Optimizing CRISPR-Cas9 gene editing for studying PIGP function in mouse models requires careful consideration of several key methodological aspects:

  • Guide RNA (gRNA) Design:

    • Target exonic regions of the Pigp gene, particularly those encoding functional domains

    • Design multiple gRNAs (at least 3-4) targeting different exons to increase editing efficiency

    • Use algorithms that predict off-target effects and select guides with high specificity scores

    • For mouse Pigp, consider targeting conserved regions shared with human PIGP to enhance translational relevance

  • Delivery Methods:

    • For mouse embryos: Microinjection of Cas9 protein:gRNA ribonucleoprotein complexes into zygotes

    • For cell lines: Lipofection, electroporation, or viral vectors (lentivirus/AAV)

    • Consider tissue-specific or inducible promoters for Cas9 expression to study tissue-specific functions

  • Editing Strategies:

    • Complete knockout: Design gRNAs targeting early exons to create frameshift mutations

    • Domain-specific modifications: Use homology-directed repair (HDR) with donor templates

    • Conditional alleles: Insert loxP sites flanking critical exons for Cre-mediated deletion

    • Knockin reporter systems: Insert fluorescent proteins to track PIGP expression patterns

  • Validation and Characterization:

    • Genomic verification: PCR and sequencing to confirm edits

    • Protein expression: Western blot with anti-PIGP antibodies (0.04-0.4 μg/mL concentration)

    • Functional assays: Measure GPI-anchored protein surface expression using flow cytometry

    • Phenotypic analysis: Focus on cellular functions dependent on GPI-anchored proteins

  • Control Considerations:

    • Include wild-type littermates as controls

    • Generate heterozygous models to study gene dosage effects

    • Create rescue models expressing wild-type PIGP to confirm specificity of phenotypes

Given PIGP's role in the first step of GPI-anchor biosynthesis, complete knockout may produce severe or lethal phenotypes. Therefore, consider generating hypomorphic alleles or conditional knockouts to study specific aspects of PIGP function in adult mice or specific tissues.

What are the most effective protein expression systems for producing functional recombinant mouse PIGP?

The selection of an optimal protein expression system for producing functional recombinant mouse PIGP depends on research objectives, required protein quality, and downstream applications. Below is a comprehensive analysis of expression systems with their respective advantages and limitations:

Table 2: Comparison of Expression Systems for Recombinant Mouse PIGP Production

Expression SystemAdvantagesLimitationsRecommended ApplicationsYield Expected
E. coli- Cost-effective
- Rapid growth
- High yield
- Simple purification
- Lacks eukaryotic PTMs
- Inclusion body formation
- Membrane protein misfolding
- Structural studies
- Antibody production
- SDS-PAGE analysis
>90% purity possible
HEK-293F Cells- Proper protein folding
- Native-like PTMs
- Secreted expression
- Higher cost
- Longer production time
- Complex media requirements
- Functional assays
- Enzyme activity studies
- Protein-protein interactions
>95% purity achievable
Cell-free Systems- Rapid production
- Avoids cell viability issues
- Direct control of reaction conditions
- Lower yield
- Higher cost per mg
- Limited scalability
- Quick screening
- Toxic protein production
- Preliminary studies
70-80% purity
Wheat Germ- Eukaryotic folding
- Good for toxic proteins
- Efficient translation
- Moderate yield
- Less common PTMs
- Technical complexity
- Structure-function studies
- Protein microarrays
Variable depending on optimization

Methodological Considerations for Optimal Expression:

  • Vector Design:

    • Include appropriate tags: His-tag (N- or C-terminal) is most common for PIGP

    • Codon optimization for the expression host

    • Selection of promoters (T7 for bacterial, CMV for mammalian)

    • Consider fusion partners (MBP, GST) to enhance solubility

  • Expression Conditions:

    • For E. coli: Expression at lower temperatures (16-25°C) improves solubility

    • For HEK-293F: Transfection efficiency optimization is critical

    • Induction parameters: IPTG concentration for bacterial systems, time of harvest

  • Purification Strategy:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged PIGP

    • Optimize buffers to maintain protein stability (Tris-based buffer with 50% glycerol has been effective)

    • Consider detergent selection for membrane protein solubilization

  • Storage and Handling:

    • Store at -20°C/-80°C for extended storage

    • Avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

The HEK-293F system has been particularly successful for producing functional mouse PIGP protein when active enzymatic function is required . For structural studies where post-translational modifications are less critical, E. coli expression followed by refolding protocols may be more cost-effective. Cell-free systems offer rapid production for preliminary studies or when optimization of expression conditions is needed.

What are the optimal methods for analyzing protein-protein interactions involving mouse PIGP in the GPI-anchor biosynthesis pathway?

Analyzing protein-protein interactions (PPIs) involving mouse PIGP in the GPI-anchor biosynthesis pathway requires specialized approaches due to PIGP's membrane localization and its participation in a multi-subunit complex. The following methodological framework provides comprehensive strategies:

  • Affinity-Based Methods:

    • Co-immunoprecipitation (Co-IP): Use anti-PIGP antibodies (such as PA5-56802) to pull down PIGP and identify interacting partners by western blotting or mass spectrometry

    • Pull-down assays: Utilize recombinant His-tagged or Strep-tagged PIGP proteins as bait

    • Crosslinking followed by IP: Apply membrane-permeable crosslinkers to stabilize transient interactions before extraction

  • Proximity-Based Approaches:

    • Proximity Ligation Assay (PLA): Detect interactions within 40 nm in fixed cells using antibody pairs

    • FRET/BRET: Tag PIGP and potential partners with appropriate fluorophore/luminescence pairs

    • BioID/TurboID: Fuse PIGP with a promiscuous biotin ligase to biotinylate proximal proteins

    • APEX proximity labeling: Attach an engineered peroxidase to PIGP for proximity-based labeling

  • Reconstitution Strategies:

    • Mammalian Two-Hybrid System: Adapt for membrane proteins like PIGP

    • Split-protein complementation: Use BiFC or split luciferase systems adapted for ER membrane proteins

    • In vitro reconstitution: Purify individual components of the GPI-GnT complex and assess complex formation

  • Advanced Biophysical Methods:

    • Surface Plasmon Resonance (SPR): Quantify binding kinetics using purified components

    • Microscale Thermophoresis (MST): Measure interactions with minimal protein consumption

    • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Map interaction interfaces

    • Blue Native PAGE: Analyze intact GPI-GnT complex associations

  • Structural Analysis Techniques:

    • Cryo-electron microscopy: Visualize the entire GPI-GnT complex architecture

    • X-ray crystallography: Determine high-resolution structures of PIGP with binding partners

    • NMR spectroscopy: Analyze dynamics of interactions for soluble domains

Practical Considerations:

When studying PIGP interactions, researchers should be aware that:

  • The GPI-GnT complex includes multiple subunits (PIGA, PIGC, PIGH, PIGQ, PIGP, and PIGY)

  • PIGP directly interacts with the catalytic subunit PIGA, suggesting a regulatory role

  • Detergent selection is critical for maintaining intact complexes during extraction

  • Validation with multiple complementary techniques is essential for confirming true interactions

For investigating novel PIGP interactions, combining proximity labeling with mass spectrometry offers high sensitivity and the ability to detect even weak or transient interactions in the native cellular environment.

How can researchers effectively assess the functional impacts of PIGP mutations or knockdowns in mouse cell lines?

Assessing the functional impacts of PIGP mutations or knockdowns in mouse cell lines requires a multi-dimensional approach that examines both molecular and cellular consequences. The following methodological framework provides a comprehensive strategy:

  • Generation of PIGP-Modified Cell Lines:

    • CRISPR-Cas9 Editing: For precise genomic modifications (point mutations, deletions)

    • siRNA/shRNA: For transient or stable knockdown of PIGP expression

    • Overexpression Systems: For complementation studies with wild-type or mutant PIGP

    • Dominant-Negative Approaches: Express catalytically inactive PIGP variants

  • Molecular Characterization:

    • Expression Analysis:

      • qRT-PCR to quantify Pigp mRNA levels

      • Western blotting using anti-PIGP antibodies to confirm protein depletion/mutation

    • Enzymatic Activity:

      • In vitro GPI-GnT activity assays measuring GlcNAc transfer to PI

      • In situ labeling of nascent GPI intermediates with radiolabeled precursors

  • GPI-Anchored Protein Analysis:

    • Flow Cytometry:

      • Quantify surface expression of known GPI-anchored proteins (CD55, CD59)

      • Use fluorescently-labeled aerolysin (FLAER) to directly detect GPI anchors

    • Immunofluorescence Microscopy:

      • Assess subcellular localization of GPI-anchored proteins

      • Co-localization studies with ER, Golgi, and plasma membrane markers

    • Biochemical Fractionation:

      • Triton X-114 phase partitioning to separate GPI-anchored proteins

      • PI-PLC sensitivity tests to confirm GPI anchor attachment

  • Cellular Phenotype Characterization:

    • Membrane Dynamics:

      • Lateral diffusion measurements using FRAP or single-particle tracking

      • Lipid raft association studies with cholesterol depletion challenges

    • Cellular Functions:

      • Cell adhesion and migration assays

      • Signaling pathway activation (especially pathways requiring GPI-anchored proteins)

      • Complement sensitivity tests (GPI anchors protect from complement-mediated lysis)

  • Rescue Experiments:

    • Re-expression of wild-type PIGP in knockout/knockdown cells

    • Structure-function analysis with domain-specific mutants

    • Cross-species complementation tests (human PIGP in mouse cells)

Data Analysis Framework:

For phenotypic characterization, researchers should employ quantitative metrics such as:

  • Percentage reduction in GPI-anchored protein surface expression

  • Half-life measurements of GPI biosynthesis intermediates

  • Dose-response relationships in partial knockdowns

  • Statistical comparison across multiple independent clones

Case Study Example:
Previous studies on related GPI biosynthesis genes have shown that complete knockout of essential components like PIGA results in absence of all GPI-anchored proteins, while hypomorphic mutations may show reduced but detectable GPI anchor synthesis. When analyzing PIGP mutations, researchers should consider the position within the protein sequence and the potential impact on interactions with other GPI-GnT subunits, particularly PIGA.

How does mouse PIGP research contribute to understanding human diseases associated with GPI-anchor deficiencies?

Mouse PIGP research provides critical insights into human diseases associated with GPI-anchor deficiencies through several methodological approaches:

  • Comparative Genomics and Structural Homology:

    • Mouse PIGP shares significant sequence homology with human PIGP (mouse-human alignment shows conserved functional domains)

    • The genomic location of PIGP in the Down syndrome critical region on human chromosome 21 suggests potential involvement in this condition

    • The fundamental GPI-anchor biosynthetic machinery is highly conserved between species, making mouse models relevant for human disease studies

  • Disease Modeling Approaches:

    • Inherited GPI Deficiencies (IGDs): Mouse models with Pigp mutations can recapitulate human IGD phenotypes

    • Down Syndrome Research: Since human PIGP is located within the Down syndrome critical region, mouse models can help dissect the contribution of PIGP overexpression to Down syndrome pathology

    • Somatic Mutations: Conditional Pigp knockout mouse models help understand tissue-specific GPI deficiency consequences

  • Molecular Mechanisms of Pathogenesis:

    • Altered GPI-anchored protein expression affects:

      • Neuronal development and function

      • Immune system regulation

      • Embryonic development

    • Mouse studies reveal downstream signaling pathways affected by GPI deficiencies

    • Identification of compensatory mechanisms that may be therapeutic targets

  • Therapeutic Development Applications:

    • Target Validation: Mouse models confirm whether PIGP modulation affects disease phenotypes

    • Preclinical Testing: Evaluating treatments that bypass or correct GPI-anchor deficiencies

    • Biomarker Discovery: Identifying measurable indicators of GPI-anchor status that correlate with disease severity

  • Clinical Correlation Insights:

    • Mouse phenotypes with various degrees of PIGP dysfunction help explain the spectrum of human disease severity

    • Identification of modifier genes that influence disease expression

    • Understanding of genotype-phenotype correlations applicable to human patients

Research Implications Table:

Human ConditionMouse PIGP Research ContributionTranslational Value
Inherited GPI DeficienciesCharacterization of developmental and biochemical consequences of PIGP mutationsInform diagnosis and classification of human GPI deficiencies
Down SyndromeUnderstanding PIGP overexpression effects on neuronal functionPotential therapeutic target for specific Down syndrome features
Paroxysmal Nocturnal HemoglobinuriaInsights into partial GPI deficiency effects on complement regulationNew approaches to treat complement-mediated disorders
Neurological DisordersRole of GPI-anchored proteins in neural development and functionNovel therapeutic strategies for developmental neurological conditions

For researchers pursuing translational studies, it's important to note that while mouse models provide valuable insights, there may be species-specific differences in GPI-anchored protein expression patterns and functions. Therefore, validation in human cellular systems is recommended before clinical application of findings from mouse PIGP research.

What are the methodological challenges in using recombinant mouse PIGP for developing targeted therapeutics?

Developing targeted therapeutics based on recombinant mouse PIGP research faces several methodological challenges that researchers must address through systematic approaches:

  • Protein Production and Stability Issues:

    • Membrane Protein Complexities: PIGP is an integral membrane protein that functions within a multi-subunit complex, making recombinant expression challenging

    • Structural Integrity: Maintaining the native conformation during purification requires specialized detergents or nanodiscs

    • Post-translational Modifications: Ensuring proper modifications that may be essential for function

    • Solution: Employ mammalian expression systems (HEK-293F) with optimized purification protocols that preserve protein-protein interactions within the GPI-GnT complex

  • Species-Specific Differences:

    • Sequence Divergence: Despite conservation, mouse and human PIGP have differences that may affect drug targeting

    • Functional Variation: Species-specific interaction partners or regulatory mechanisms

    • Solution: Conduct parallel studies with both mouse and human PIGP, focusing on conserved domains as therapeutic targets

  • Target Validation Complexities:

    • Redundancy in GPI Pathway: Compensatory mechanisms may diminish therapeutic effects

    • Developmental Timing: GPI-anchor importance varies across developmental stages

    • Solution: Use conditional and tissue-specific knockouts to establish precise therapeutic windows and contexts

  • Therapeutic Delivery Challenges:

    • Subcellular Localization: PIGP resides in the ER membrane, requiring therapeutics to penetrate multiple cellular barriers

    • Tissue Targeting: Delivering therapeutics to relevant tissues (e.g., brain for neurological applications)

    • Solution: Develop lipid nanoparticles, cell-penetrating peptides, or antibody-drug conjugates for targeted delivery

  • Assay Development for Drug Screening:

    • Complex Enzymatic Activity: PIGP functions as part of a multi-enzyme complex, complicating high-throughput assays

    • Physiological Relevance: In vitro assays may not recapitulate in vivo complexity

    • Solution: Develop cell-based reporter systems using GPI-anchored proteins as functional readouts

  • Safety Considerations:

    • Pathway Criticality: GPI biosynthesis is essential for many cellular functions

    • Off-Target Effects: Modulating PIGP may affect multiple GPI-anchored proteins simultaneously

    • Solution: Pursue partial modulation rather than complete inhibition; focus on specific protein-protein interactions

Experimental Approach Table for Therapeutic Development:

Development StageChallengeMethodological SolutionTechnical Considerations
Target ValidationEstablishing causality between PIGP and disease phenotypesCRISPR-based models with varying degrees of PIGP depletionMonitor GPI-anchored protein levels by flow cytometry using FLAER reagent
Assay DevelopmentCreating physiologically relevant high-throughput screening platformsSplit-luciferase complementation assays for PIGP-partner interactionsOptimize signal-to-noise ratio and minimize false positives
Lead IdentificationIdentifying compounds that specifically modulate PIGP functionFragment-based screening against purified GPI-GnT complexEnsure compounds can access ER membrane in cellular context
Lead OptimizationImproving potency while maintaining specificityStructure-guided medicinal chemistry focusing on PIGP interaction interfacesBalance membrane permeability with target engagement
Preclinical TestingTranslating mouse findings to human applicationsHumanized mouse models expressing human PIGPDevelop biomarkers to monitor therapeutic efficacy

Researchers addressing these challenges should adopt an integrated approach that combines structural biology, chemical biology, and systems-level analysis to develop truly effective PIGP-targeted therapeutics. The recent advances in cryo-EM and computational drug design offer new opportunities to overcome many of these obstacles.

How can single-cell analysis techniques be applied to study PIGP function and GPI-anchor biosynthesis?

Single-cell analysis techniques offer unprecedented insights into cellular heterogeneity and can revolutionize our understanding of PIGP function and GPI-anchor biosynthesis. Here's a comprehensive methodological framework for applying these technologies:

  • Single-Cell Transcriptomics:

    • scRNA-seq Applications:

      • Profile Pigp expression across cell populations and states

      • Identify co-expression patterns with other GPI biosynthesis genes

      • Detect compensatory transcriptional responses to Pigp dysfunction

    • Methodological Considerations:

      • Droplet-based methods (10X Genomics) for high-throughput profiling

      • Smart-seq2 for full-length transcript analysis when splice variants are relevant

      • Spatial transcriptomics to correlate Pigp expression with tissue architecture

  • Single-Cell Proteomics:

    • Mass Cytometry (CyTOF) Applications:

      • Quantify multiple GPI-anchored proteins simultaneously at single-cell resolution

      • Correlate PIGP levels with downstream GPI-anchored protein expression

      • Analyze signaling pathways affected by PIGP modulation

    • Single-Cell Western Blot:

      • Directly measure PIGP protein levels in individual cells

      • Assess correlation between PIGP abundance and enzymatic function

  • Functional Single-Cell Analysis:

    • Flow Cytometry with FLAER:

      • Quantify GPI-anchor abundance at single-cell resolution

      • Sort cells based on GPI-anchor levels for subsequent molecular analysis

      • Track changes in GPI-anchor synthesis over time

    • Live-Cell Imaging:

      • Monitor GPI-anchored protein trafficking in individual cells

      • FRAP analysis to assess membrane dynamics dependent on GPI anchors

      • FRET-based biosensors to detect GPI biosynthesis intermediates

  • Single-Cell Genomics:

    • CRISPR Screens at Single-Cell Resolution:

      • Perturb Pigp and other GPI pathway genes in pooled formats

      • Link genetic perturbations to phenotypic outcomes at single-cell level

      • Identify genetic interactions through combinatorial CRISPR approaches

    • Lineage Tracing:

      • Track the consequences of Pigp mutations through development

      • Analyze competitive fitness of cells with varying PIGP activity

  • Integrated Multi-omics Approaches:

    • CITE-seq/REAP-seq:

      • Simultaneously profile transcriptome and GPI-anchored surface proteins

      • Correlate Pigp mRNA levels with functional outcomes

    • Single-Cell Multi-omics:

      • Combine genomic, transcriptomic, and proteomic data from the same cells

      • Create comprehensive models of GPI biosynthesis regulation

Implementation Strategy Table:

TechniquePrimary ApplicationTechnical RequirementsData Analysis Approach
scRNA-seqExpression heterogeneity of GPI pathway genesSingle-cell isolation system, library preparation kitsDimensionality reduction, clustering, trajectory analysis
Mass CytometryQuantification of multiple GPI-anchored proteinsMetal-conjugated antibodies against GPI-anchored proteinsviSNE, SPADE, or FlowSOM clustering algorithms
FLAER Flow CytometryDirect measurement of GPI-anchor abundanceFLAER reagent, flow cytometer with appropriate lasersHistogram analysis, population gating strategies
Single-Cell CRISPR ScreeningFunctional genomics of GPI pathwayLentiviral delivery system, single-cell sequencing platformCRISPR guide counting, phenotype association

For researchers implementing these approaches, it's important to first validate techniques with positive controls (e.g., known GPI-anchor deficient cells) and to incorporate appropriate statistical methods for handling the high dimensionality and technical noise inherent to single-cell data.

What emerging technologies are most promising for studying the structural dynamics of PIGP within the GPI-GnT complex?

Emerging technologies for studying the structural dynamics of PIGP within the GPI-GnT complex are revolutionizing our understanding of this essential enzymatic machinery. The following methodological framework highlights the most promising approaches:

  • Advanced Cryo-Electron Microscopy (Cryo-EM):

    • Single-Particle Analysis:

      • Achieves near-atomic resolution of membrane protein complexes without crystallization

      • Captures multiple conformational states of the GPI-GnT complex

      • Reveals PIGP's position and interactions within the multiprotein assembly

    • Cryo-Electron Tomography:

      • Visualizes the GPI-GnT complex in its native cellular environment

      • Maps spatial relationships with other ER membrane proteins and complexes

    • Technical Considerations:

      • Requires optimization of detergent solubilization or nanodiscs to maintain complex integrity

      • Benefits from recombinant expression systems that yield homogeneous preparations

  • Integrative Structural Biology Approaches:

    • Cross-linking Mass Spectrometry (XL-MS):

      • Maps protein-protein interaction interfaces within the GPI-GnT complex

      • Identifies dynamic regions through differential cross-linking patterns

      • Provides distance constraints for computational modeling

    • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

      • Probes solvent accessibility and conformational dynamics

      • Identifies regions of PIGP that undergo structural changes during catalysis

      • Requires minimal protein amounts compared to traditional structural techniques

  • Advanced Spectroscopic Methods:

    • Single-Molecule FRET:

      • Monitors real-time conformational changes in PIGP during catalysis

      • Requires strategic placement of fluorophores on recombinant PIGP

      • Provides insights into the kinetics of structural transitions

    • Electron Paramagnetic Resonance (EPR) Spectroscopy:

      • Measures distances between spin-labeled residues in PIGP

      • Works particularly well for membrane proteins where crystallization is challenging

      • Site-directed spin labeling allows precise mapping of structural features

  • Computational Approaches:

    • AlphaFold2/RoseTTAFold Enhanced Prediction:

      • Generates highly accurate structural models of PIGP and its complex partners

      • Integration with experimental data improves accuracy for membrane proteins

      • Enables prediction of interaction interfaces and functional conformations

    • Molecular Dynamics Simulations:

      • Models dynamic behavior of PIGP within lipid bilayers

      • Simulates substrate binding and catalytic mechanisms

      • Predicts effects of mutations on structure and function

  • Innovative Labeling Strategies:

    • Genetic Code Expansion:

      • Incorporates unnatural amino acids for site-specific biophysical probes

      • Enables installation of photo-crosslinkers to capture transient interactions

      • Minimally perturbs protein structure compared to traditional tagging

    • Proximity Labeling with Engineered Enzymes:

      • TurboID or APEX2 fused to PIGP for in situ mapping of the neighborhood

      • Identifies transient interactors not captured by affinity purification

      • Works in native cellular environments without complex purification

Implementation Table for Structural Studies of PIGP:

TechnologyKey AdvantageSample RequirementsResolution RangeApplication to PIGP Studies
Cryo-EM Single-Particle AnalysisVisualizes entire complex architecture~0.1 mg purified complex2.5-4 ÅDetermine PIGP position and interfaces within GPI-GnT complex
Cross-linking Mass SpectrometryMaps protein-protein interactions~50 μg complexResidue-specific contactsIdentify PIGP binding partners and interfaces
AlphaFold2 ModelingNo experimental sample neededSequence information only2-5 Å (predicted)Generate structural hypotheses for experimental validation
Single-Molecule FRETCaptures dynamic processesSite-specifically labeled protein10-100 Å distancesMonitor conformational changes during catalysis
HDX-MSProbes dynamics and solvent accessibility~50 μg proteinPeptide-level resolutionIdentify flexible regions and conformational changes

For researchers implementing these technologies, an integrative approach combining multiple methods will provide the most comprehensive understanding of PIGP structure and dynamics. Starting with computational predictions to guide experimental design, followed by validation and refinement using experimental techniques, represents an efficient strategy for elucidating the structural basis of PIGP function within the GPI-GnT complex.

What are the most critical unanswered questions about mouse PIGP that require further research?

Despite significant advances in our understanding of mouse PIGP, several critical questions remain unresolved. These knowledge gaps represent prime opportunities for future research directions:

  • Structural-Functional Relationships:

    • What is the precise three-dimensional structure of PIGP within the intact GPI-GnT complex?

    • Which specific amino acid residues in PIGP are essential for its interaction with other complex subunits, particularly PIGA?

    • How does PIGP contribute to the catalytic mechanism of GlcNAc transfer to PI?

  • Regulatory Mechanisms:

    • How is PIGP expression regulated at transcriptional and post-transcriptional levels?

    • Are there tissue-specific regulatory mechanisms controlling PIGP function?

    • What post-translational modifications occur on PIGP, and how do they affect its activity?

    • Does PIGP have any moonlighting functions beyond its role in GPI biosynthesis?

  • Developmental and Physiological Roles:

    • What are the tissue-specific consequences of PIGP dysfunction during embryonic development?

    • How does PIGP contribute to the maintenance of specific cell types or tissues?

    • Are there compensatory mechanisms that can rescue partial PIGP deficiency?

    • What is the impact of aging on PIGP expression and function?

  • Pathological Implications:

    • How do PIGP variants contribute to disease susceptibility or progression?

    • What is the specific contribution of PIGP to Down syndrome pathology, given its location in the critical region?

    • Are there acquired somatic mutations in PIGP that contribute to disease states?

    • How does PIGP dysfunction affect specific cellular processes such as immune response or neuronal function?

  • Therapeutic Potential:

    • Can targeted modulation of PIGP activity provide therapeutic benefits in specific disease contexts?

    • What are the most promising approaches for enhancing or inhibiting PIGP function?

    • How can we develop cell type-specific delivery systems for PIGP-targeted therapeutics?

    • What are the consequences of partial vs. complete PIGP inhibition in mature organisms?

These questions highlight the need for integrated research approaches combining structural biology, functional genomics, developmental biology, and translational medicine to fully unlock the biological significance of PIGP and its potential as a therapeutic target.

How can researchers optimize experimental design when working with recombinant mouse PIGP to ensure reproducible results?

Ensuring reproducible results when working with recombinant mouse PIGP requires careful attention to experimental design, quality control, and standardized protocols. The following comprehensive framework addresses key methodological considerations:

  • Protein Production and Characterization:

    • Expression System Selection:

      • Match the expression system to the experimental purpose (E. coli for structural studies, mammalian cells for functional assays)

      • Document complete expression conditions including cell line, vector, tags, and induction parameters

    • Quality Control Metrics:

      • Verify protein identity through mass spectrometry or N-terminal sequencing

      • Assess purity via SDS-PAGE (aim for >90% purity)

      • Confirm proper folding through circular dichroism or limited proteolysis

      • Test functional activity using defined enzymatic assays

  • Storage and Handling Practices:

    • Standardized Storage Protocols:

      • Store at -20°C/-80°C for long-term storage

      • Avoid repeated freeze-thaw cycles (prepare single-use aliquots)

      • Working aliquots can be stored at 4°C for up to one week

    • Buffer Composition Documentation:

      • Tris-based buffer with 50% glycerol has been effective for PIGP stability

      • Document all buffer components including pH, salt concentration, and additives

      • Consider carrier-free formulations when BSA might interfere with downstream applications

  • Experimental Design Principles:

    • Controls Implementation:

      • Include positive controls (known functional PIGP preparations)

      • Use negative controls (heat-inactivated PIGP, irrelevant proteins)

      • Internal references for normalization across experiments

    • Sample Size and Replication Strategy:

      • Perform technical triplicates for each biological replicate

      • Use at least three independent biological replicates (different protein preparations)

      • Perform power analysis to determine appropriate sample sizes

  • Documentation and Reporting Standards:

    • Detailed Methods Documentation:

      • Document complete protein sequence including any tags

      • Specify concentration determination method (e.g., Bradford assay, A280)

      • Record lot numbers and sources of all key reagents

    • Data Management Practices:

      • Maintain comprehensive research notebooks with raw data

      • Implement structured file naming conventions

      • Establish data backup protocols

  • Protocol Standardization and Validation:

    • Assay Validation:

      • Determine assay precision, accuracy, and limits of detection

      • Document linearity ranges for quantitative measurements

      • Establish acceptance criteria for experimental outcomes

    • Inter-laboratory Validation:

      • Exchange protocols and samples with collaborating laboratories

      • Participate in ring trials where possible

Practical Implementation Table:

Experimental PhaseCommon PitfallsRecommended PracticesQuality Control Checkpoints
Protein ProductionBatch-to-batch variabilityStandardize expression conditions; document cell passage numberSDS-PAGE, Western blot, activity assays for each batch
Protein StorageActivity loss during storageSingle-use aliquots; optimal buffer conditions (Tris-based buffer, 50% glycerol) Periodic retesting of activity; stability studies
Functional AssaysNon-specific effects, assay driftInclude proper controls; calibrate instruments regularlyZ'-factor determination; standard curve with each experiment
Data AnalysisSelective reporting, inappropriate statisticsPre-register analysis plans; consult statisticianBlinded analysis where possible; report all replicates

By implementing these rigorous approaches to experimental design and quality control, researchers can significantly enhance the reproducibility of results when working with recombinant mouse PIGP. This framework not only improves scientific rigor but also facilitates downstream applications and translational research efforts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.