Recombinant Mouse Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q (Pigq)

Shipped with Ice Packs
In Stock

Description

Function in GPI Biosynthesis

Pigq is part of the GPI-N-acetylglucosaminyltransferase (GPI-GnT) complex, which catalyzes the first step in GPI biosynthesis: transferring N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to phosphatidylinositol (PI) . This reaction forms GlcNAc-PI, a precursor for GPI anchors.

Role in the Enzyme Complex

The GPI-GnT complex includes six core subunits in mammals:

  1. PIGA (catalytic subunit)

  2. PIGH

  3. PIGC

  4. GPI1

  5. PIGP

  6. DPM2

Pigq interacts directly with PIGA and PIGC, stabilizing the complex and enabling enzymatic activity . In S. cerevisiae, a homologous subunit (Eri1p) regulates GPI-GnT activity, but no direct functional linkage to Ras GTPases has been confirmed in mammals .

Production and Purification

ParameterDetails
Expression SystemE. coli
PurificationAffinity chromatography (His-tag)
Purity>90% (SDS-PAGE-confirmed)
Storage BufferTris/PBS-based buffer with 6% trehalose and 50% glycerol (optional)
StabilityAvoid repeated freeze-thaw cycles; store at -20°C/-80°C

Disease Associations

Mutations in Pigq are linked to Multiple Congenital Anomalies-Hypotonia-Seizures Syndrome 4 (MCAHS4) and epilepsy, underscoring its role in neuronal development and function .

Experimental Uses

  • Enzyme Activity Assays: Studies on GPI-GnT kinetics and subunit interactions .

  • Structural Biology: Crystallization and X-ray diffraction studies to map catalytic sites .

  • Disease Modeling: Knockout models to explore GPI deficiency phenotypes .

Interactions and Complex Formation

Pigq forms stable interactions with:

SubunitRole in ComplexSource
PIGACatalytic subunit
PIGCStabilizes PIGA
PIGHRegulatory subunit

These interactions ensure proper localization of the complex to the ER membrane and coordination of enzymatic activity .

Clinical and Research Significance

Pigq serves as a critical tool for:

  1. GPI-Anchor Pathway Studies: Elucidating mechanisms of protein anchoring .

  2. Therapeutic Targeting: Investigating GPI deficiencies in neurological disorders .

  3. Diagnostic Biomarkers: Identifying mutations linked to congenital syndromes .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
Pigq; Gpi1h; Mgpi1; Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q; MGpi1p; N-acetylglucosamyl transferase component GPI1; Phosphatidylinositol-glycan biosynthesis class Q protein; PIG-Q
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-581
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Pigq
Target Protein Sequence
VLKVFFPTCCASADSGLLVGRWVPGQSSAVILAVVHFPFIPIQVKELLAQVQKASQVPVA VLGTWCHRQQEPQESLGNFLEGLGTIFSHDPWLQLCRERGTRLWSCKATYPQMSNPLDMH PEEQVMLIFYDQRKLLLSWLHPPPVLPACQMGDTTASTGGLADIFDTVARSEVLFRNDQF DERPVRLSHWQSEGVEASILVELAKRASGPVCLLLASLLSLISAASACRLWKLWPLSFIR SKLSTCEQLHHRLKHLSFIFSTEKAQNPMQLMRKANMLVSVLLDVALGLLLLSWLHSNNR IGQLANALVPVADRVAEELQHLLQWLMGAPAGLKMNRALDQVLGRFFLYHIHLWISYIHL MSPFIEHILWHVGLSACLGLTVALSIFSDIIALLTFHIYCFYVYGARLYCLKIYGLSSLW RLFRGKKWNVLRQRVDSCSYDLDQLFIGTLLFTILVFLLPTTALYYLVFTLLRLLVITVQ GLIHLLVDLINSLPLYSLGLRLCRPYRLAAGVKFRVLEKEAGRPLRLLMQINPLSYNHVM HIYRLPRCGCHPKHSWGTLCRKLVFGELIYPWRQREDKQD
Uniprot No.

Target Background

Function
Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q (Pigq) is a component of the glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex. It plays a crucial role in catalyzing the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, participating in the initial step of GPI biosynthesis.
Database Links
Protein Families
PIGQ family
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.