Recombinant Mouse Phospholipid scramblase 4 (Plscr4)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Overview

  • Gene Identification: Plscr4 is located on chromosome 3q24 in mice (NCBI Gene ID: 235527) and encodes a 326-amino-acid protein with a molecular mass of ~37 kDa .

  • Functional Domains: The protein contains calcium-binding motifs critical for its scramblase activity, enabling bidirectional phospholipid flipping in membranes .

  • Tissue Expression: Highest expression in adipose tissue, with roles in adipogenesis and lipid metabolism .

Recombinant Protein Tags and Modifications

Recombinant Plscr4 is engineered with tags to enhance solubility and purification:

Tag TypePurposeSource
His-tagMetal affinity purificationE. coli (RFL3196MF)
GST-tagSolubility enhancementE. coli (Plscr4-1952M)
Fc-tagAntibody-like stabilityMammalian systems (PLSCR4-3298R)

Role in Adipogenesis and Lipid Metabolism

  • Adipocyte Differentiation: PLSCR4 knockdown in adipose progenitor cells increases lipid accumulation and adipogenesis, linked to elevated PIP3/AKT signaling . Overexpression reduces lipid storage.

  • PTEN-Associated Lipomas: PLSCR4 downregulation in PTEN-deficient models correlates with adipose-tissue overgrowth, suggesting a regulatory role in PI3K/AKT pathways .

Biomarker Potential in Sickle Cell Disease (SCD)

  • Vaso-Occlusive Crisis (VOC): PLSCR4 is upregulated 6-fold in SCD patients during VOC, associated with hemolysis and thrombosis .

  • Mechanism: Mediates phosphatidylserine externalization, promoting erythrocyte adhesion and vascular occlusion .

Gene Therapy and Experimental Models

  • AAV Vectors: Recombinant Plscr4 is delivered via adeno-associated viruses (AAV) for overexpression studies in mice, enabling in vivo analysis of scramblase activity .

Table 1: Key Research Insights

Study FocusObservationModelSource
AdipogenesisPLSCR4 KD ↑ lipid accumulation; OE ↓ adipocyte differentiationMouse APCs
SCD BiomarkerPLSCR4 ↑6-fold in VOC vs. steady-state; linked to hemolysisHuman SCD patients
PTEN DeficiencyPLSCR4 ↓ in PTEN KD cells; correlates with lipoma formationMouse lipoma cells

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preferences during order placement. We will fulfill your requests as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for the most accurate delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. Should you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. You can use this as a reference.
Shelf Life
Shelf life can be influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
Plscr4; Phospholipid scramblase 4; PL scramblase 4; Ca(2+-dependent phospholipid scramblase 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-326
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Plscr4
Target Protein Sequence
MSGLVPTAPEQPTEEMENQIKSPTAVPDAPPDYNSHFAPGPAGPVASPSAGLPMGYYIPQQPGAIPLYHPTGGTHPIQYQPGKYPVTNQPAPIMWMAGPAPVPNCPPGLEYLAQLDNIHVLQHVEPLELMTRFETNNRYDIKNNIDQMVYIVTEDTDDFTRNAYRNLRPFVLRVTDCLGREIMTMQRPFRCTCCCFCCPCARQELEVQCPPGVTIGFVAEHWNLCRASYSIQNEKKESMMRVRGPCATYGCGSDSVFEINSLDGVSNIGSIIRKWNGFLSTMVNADHFEIRFPLALDVKMKAMIFGSCFLIDFMYFERPPPRRMSR
Uniprot No.

Target Background

Function
Phospholipid scramblase 4 (Plscr4) may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions. This action can lead to a loss of phospholipid asymmetry in the plasma membrane. Plscr4 may play a crucial role in the initiation of fibrin clot formation, the activation of mast cells, and the recognition of apoptotic and injured cells by the reticuloendothelial system.
Gene References Into Functions
  1. Lipopolysaccharide treatment resulted in increased expression of phospholipid scramblase 1 (PLSCR-1) and decreased expression of phospholipid scramblase 4 (Plscr4) messenger RNA, demonstrating modulation of PLSCR-1 and PLSCR-4 in lipopolysaccharide-induced preterm birth. PMID: 22598484
Database Links
Protein Families
Phospholipid scramblase family
Subcellular Location
Membrane; Single-pass type II membrane protein.

Q&A

What is Phospholipid Scramblase 4 (PLSCR4) and how does it differ from other scramblase family members?

PLSCR4 is a single-pass plasma membrane protein that mediates the transbilayer movement of phospholipids across lipid bilayers. It belongs to a family of five human phospholipid scramblases (PLSCR1-5) that exhibit distinct tissue specificity. While PLSCR1 is predominantly expressed in heart, liver, kidney, and pancreas, PLSCR2 in testis, and PLSCR3 in muscles, endometrium, and adipose tissue, PLSCR4 is most highly expressed in human adipose tissue, suggesting a specific role in adipose tissue biology . Unlike PLSCR3 and PLSCR1, which have been extensively studied in fat mass regulation and shown to affect abdominal fat accumulation when knocked out, PLSCR4's specific functions have only recently begun to be elucidated . Structurally, PLSCR4 shares the calcium-binding domain characteristic of scramblases that enables calcium-dependent phospholipid translocation across membranes.

What is the primary molecular function of PLSCR4 in cellular membranes?

PLSCR4 primarily mediates the accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions, resulting in loss of phospholipid asymmetry in the plasma membrane . This function is critical for several cellular processes, including exposing phosphatidylserine (PS) on the outer leaflet of the plasma membrane . Research has demonstrated that PLSCR4 specifically transports PS to the outside of the cell membrane in a calcium-dependent manner, which plays important roles in multiple pathological processes including inflammatory responses . Additionally, PLSCR4 can interact with specific proteins, including CD4 receptors on T lymphocytes and gasdermin D (GSDMD), suggesting functions beyond simple lipid translocation .

How does PLSCR4 regulate adipocyte differentiation and lipid accumulation?

PLSCR4 has been identified as a negative regulator of adipogenesis. Experimental evidence shows that PLSCR4 knockdown in adipose progenitor cells (APCs) significantly increases adipogenesis, while PLSCR4 overexpression attenuates lipid accumulation . The mechanism appears to involve regulation of the PI3K/AKT signaling pathway. When PLSCR4 is knocked down, cellular PIP3 levels increase approximately 1.92-fold, leading to enhanced AKT phosphorylation . This activation of AKT promotes the expression of lipogenic transcription factors such as sterol regulatory element-binding protein 1 (SREBP1), which is known to be regulated by the AKT target FOXO1 . In cell and mouse models of lipid accumulation, PLSCR4 was consistently found to be downregulated, further supporting its role as a negative regulator of adipogenesis .

What evidence supports PLSCR4's involvement in PTEN-associated adipose tissue disorders?

PLSCR4 is significantly downregulated in adipose progenitor cell models with deficiency for phosphatase and tensin homolog (PTEN) . This connection is particularly relevant because PTEN acts as a tumor suppressor and antagonist of the PI3K/AKT signaling cascade by dephosphorylating PIP3. Patients with PTEN germline deletion frequently develop lipomas (benign tumors composed of adipose tissue), though the mechanism for this aberrant adipose tissue growth has been incompletely understood . Research has established that PLSCR4 knockdown is associated with increased PIP3 levels and activation of AKT, similar to what occurs with PTEN deficiency . Furthermore, comparison of gene expression datasets from PTEN-knockdown APCs with other models of fat accumulation identified PLSCR4 as one of the genes significantly regulated across all models, indicating it may be a central mediator in the PTEN-adipose tissue growth pathway .

How does PLSCR4 interact with the PI3K/AKT signaling pathway?

PLSCR4 functions as a regulator of the PI3K/AKT signaling pathway through its effects on phosphoinositide levels in the cell membrane. When PLSCR4 is knocked down in adipose progenitor cells, PIP3 levels increase by approximately 1.92-fold (±0.21) as measured by immunofluorescence staining . This increase in PIP3 leads to enhanced phosphorylation and activation of AKT. Conversely, PIP2 levels are reduced by 23.1% (±4.7%) in PLSCR4 knockdown cells as determined via high-performance liquid chromatography-mass spectrometry (HPLC-MS) measurements . The activated AKT pathway subsequently influences downstream targets, including FOXO1, which regulates the expression of lipogenic transcription factors such as SREBP1. Experimental evidence shows SREBP1 protein is elevated by 28.9% (±11.6%) in PLSCR4 knockdown cells compared to control cells . This molecular cascade explains how PLSCR4 deficiency promotes adipogenesis and lipid accumulation through enhanced PI3K/AKT signaling.

What is the relationship between PLSCR4 and phosphatidylserine (PS) translocation in cellular responses?

PLSCR4, like other scramblase family members, mediates the translocation of phospholipids, particularly phosphatidylserine (PS), across the plasma membrane in a calcium-dependent manner . Research has shown that PLSCR4 specifically transports PS to the outside of the cell membrane, which affects multiple cellular processes . The exofacial exposure of PS has been identified as an important marker in various pathological processes, including inflammatory responses. In the context of pyroptosis (an inflammatory form of programmed cell death), PLSCR4's ability to transport PS may interfere with the function of gasdermin D (GSDMD), the executive protein of pyroptosis . Studies suggest that by transporting PS to the outside of the membrane, PLSCR4 can block the formation of pyroptosis pores composed of GSDMD, thereby alleviating pyroptosis-mediated cellular damage . This mechanism has been particularly studied in LPS-induced acute respiratory distress syndrome (ARDS) models.

What are the optimal methods for expressing and purifying recombinant mouse PLSCR4 for in vitro studies?

For effective expression and purification of recombinant mouse PLSCR4, researchers should consider the following methodological approach:

  • Expression System Selection: A mammalian expression system (typically HEK293 or CHO cells) is preferred over bacterial systems to ensure proper post-translational modifications. For mouse PLSCR4, the codon-optimized sequence should be cloned into a vector with a strong promoter (such as CMV) and an appropriate tag (His or FLAG) for purification .

  • Transfection and Culture Conditions: Transient transfection using lipofectamine or similar reagents typically yields sufficient protein. Cells should be cultured for 48-72 hours post-transfection in serum-free medium to minimize contamination with serum proteins during purification .

  • Membrane Protein Extraction: Since PLSCR4 is a membrane protein, extraction requires careful solubilization. A buffer containing 1% n-dodecyl-β-D-maltoside (DDM) or 1% digitonin, supplemented with protease inhibitors, has been shown to effectively solubilize PLSCR4 while preserving its functional activity .

  • Affinity Purification: For His-tagged PLSCR4, immobilized metal affinity chromatography using Ni-NTA resin is effective. The protein should be eluted with an imidazole gradient (50-250 mM). For FLAG-tagged constructs, anti-FLAG affinity resin can be used with elution using FLAG peptide .

  • Buffer Optimization: The final purified PLSCR4 should be stored in a buffer containing 20 mM HEPES (pH 7.4), 150 mM NaCl, 0.05% DDM or digitonin, and 10% glycerol to maintain stability. The addition of 1 mM EDTA or 1 mM CaCl₂ can be considered depending on whether calcium-free or calcium-bound states are desired for functional studies .

Yield and purity assessments should be performed using SDS-PAGE, Western blotting with anti-PLSCR4 antibodies, and mass spectrometry to confirm protein identity.

What are the validated approaches for studying PLSCR4 function in cellular models?

To effectively study PLSCR4 function in cellular models, researchers have validated several approaches:

  • Gene Manipulation Techniques:

    • RNA Interference: Small interfering RNA (siRNA) targeting PLSCR4 has been successfully used to knockdown expression. Transfection with PLSCR4 siRNA or scramble siRNA (sc siRNA) as control using lipofectamine 2000 has been validated in multiple cell types including human pulmonary microvascular endothelial cells (HPMECs) and adipose progenitor cells .

    • Overexpression Studies: Plasmid-based overexpression of PLSCR4 using vectors with strong promoters has been effective for gain-of-function studies, particularly in adipose tissue models .

  • Functional Assays:

    • Phospholipid Translocation Assays: Using fluorescently labeled phospholipid analogs (such as NBD-PS) to track lipid movement across membranes in the presence of calcium. Flow cytometry or fluorescence microscopy can be used to quantify PS exposure .

    • PIP3/PIP2 Level Determination: Immunofluorescence staining for PIP3 and HPLC-MS for PIP2 quantification have been validated as reliable methods to assess changes in phosphoinositide levels in response to PLSCR4 manipulation .

  • Protein Interaction Studies:

    • Co-immunoprecipitation: Successfully used to detect interactions between PLSCR4 and potential binding partners such as GSDMD or CD4 .

    • Yeast Two-Hybrid System: Validated for studying direct protein-protein interactions, particularly for identifying novel PLSCR4 binding partners .

    • Proximity Ligation Assays: Useful for visualizing protein interactions in situ.

  • Phenotypic Assessment:

    • Adipogenesis Assays: Oil Red O staining to quantify lipid accumulation in adipocyte differentiation models when PLSCR4 is manipulated .

    • Cell Death Assays: Measuring pyroptosis markers (IL-1β release, LDH release) to assess PLSCR4's role in inflammatory cell death pathways .

These approaches have been successfully implemented in published research and provide a comprehensive toolkit for investigating PLSCR4 function in various cellular contexts.

How is PLSCR4 involved in inflammatory conditions such as acute respiratory distress syndrome (ARDS)?

PLSCR4 plays a significant role in inflammatory conditions, particularly in acute respiratory distress syndrome (ARDS). Research has found that PLSCR4 mRNA is significantly increased in lipopolysaccharide (LPS)-induced ARDS models of human pulmonary microvascular endothelial cells (HPMECs) . The involvement of PLSCR4 in ARDS appears to be mediated through its effects on pyroptosis, an inflammatory form of programmed cell death.

Mechanistically, PLSCR4 alleviates pyroptosis by transporting phosphatidylserine (PS) to the outside of the cell membrane, which blocks the formation of pyroptosis pores composed of gasdermin D (GSDMD) . This protective function has been demonstrated in experiments where knockdown of PLSCR4 using siRNA exacerbated LPS-induced cellular damage, while maintaining PLSCR4 expression protected against such damage.

In mouse models of ARDS, administration of PLSCR4 siRNA/lipofectamine 2000 complex through the fundus venous plexus altered disease progression . Additionally, studies have identified potential transcription factors regulating PLSCR4 expression during inflammatory conditions, with P62280 suggested as a candidate transcription factor . These findings highlight PLSCR4 as a potential therapeutic target for inflammatory conditions like ARDS, where modulation of its expression or activity could potentially mitigate disease severity.

What evidence supports the role of PLSCR4 in viral infection processes, particularly in relation to HIV-1?

Research has identified PLSCR4 as a cellular receptor with significant implications for viral infections, particularly HIV-1. Studies have demonstrated that PLSCR4 can directly interact with the CD4 receptor at the cell surface of T lymphocytes, which is the primary receptor for HIV-1 entry . This interaction occurs at the cytoplasmic domain of PLSCR4 and may influence viral entry and infection processes.

Furthermore, PLSCR4 has been identified as a direct binding partner for secretory leukocyte protease inhibitor (SLPI), a protein found in saliva that has anti-HIV-1 properties . Experimental evidence shows that SLPI can inhibit HIV-1 infection of primary T lymphocytes when used at physiological concentrations found in saliva, and it can also inhibit the transfer of HIV-1 virions from dendritic cells to T lymphocytes . The proposed mechanism suggests that SLPI's inhibitory effect results from its ability to modulate the interaction between CD4 receptors and scramblases like PLSCR4.

This research suggests a model where the disruption of interactions between CD4 and scramblases, including PLSCR4, may represent potential targets for antiviral intervention . The dual role of PLSCR4 in both binding CD4 and serving as a receptor for anti-HIV proteins like SLPI positions it as an important molecule in understanding viral entry mechanisms and developing potential therapeutic strategies.

How do post-translational modifications affect PLSCR4 function and localization?

Post-translational modifications (PTMs) of PLSCR4 play critical roles in regulating its function, activity, and subcellular localization, though this area remains less extensively studied compared to other scramblase family members like PLSCR1. Based on sequence homology and limited experimental evidence, several key PTMs likely influence PLSCR4 function:

  • Palmitoylation: Similar to PLSCR1, PLSCR4 contains a conserved cysteine-rich region near its C-terminus that is likely subject to palmitoylation. This lipid modification is crucial for anchoring PLSCR4 to the plasma membrane. When palmitoylation is inhibited or these cysteine residues are mutated, PLSCR4 localization shifts from the plasma membrane to the cytoplasm and nucleus, dramatically altering its ability to participate in phospholipid scrambling .

  • Phosphorylation: PLSCR4 contains multiple potential phosphorylation sites, primarily on serine, threonine, and tyrosine residues. Phosphorylation by kinases such as protein kinase C (PKC) and certain tyrosine kinases likely modulates PLSCR4's scramblase activity and protein-protein interactions. In particular, phosphorylation states may influence PLSCR4's interaction with CD4 receptors and its ability to regulate the PI3K/AKT pathway .

  • Calcium Binding: Though not strictly a PTM, calcium binding to PLSCR4's calcium-binding motif induces conformational changes that are essential for its scramblase activity. This calcium-dependent regulation represents a key mechanism controlling PLSCR4 function in response to cellular calcium fluctuations .

Methodologically, studying these modifications requires techniques such as mass spectrometry for identification of modification sites, site-directed mutagenesis to create non-modifiable variants, and subcellular fractionation combined with immunofluorescence to track localization changes.

What is the three-dimensional structure of PLSCR4 and how does it relate to function?

The three-dimensional structure of PLSCR4 has not been fully determined experimentally, representing a significant gap in our understanding of this protein's function. Based on computational predictions and homology modeling with better-characterized scramblases, PLSCR4 likely contains:

  • Transmembrane Domain: A single transmembrane alpha-helix near the C-terminus that anchors the protein to the plasma membrane. This unusual topology (with most of the protein on the cytoplasmic side) is critical for its ability to facilitate phospholipid movement across the membrane .

  • Calcium-Binding Domain: A region containing an EF-hand-like motif that binds calcium ions, triggering conformational changes necessary for scramblase activity. This domain is likely located in the cytoplasmic region of the protein .

  • Protein Interaction Domains: Regions responsible for binding to partner proteins like CD4 receptors and GSDMD. These include potential SH3-binding motifs, as suggested by Gene Ontology annotations indicating SH3 domain binding capability .

  • DNA-Binding Motif: Some scramblases, including potentially PLSCR4, contain a DNA-binding domain that may facilitate nuclear functions when the protein is not palmitoylated and localizes to the nucleus.

Functionally, the scramblase activity of PLSCR4 likely involves calcium-induced conformational changes that create a pathway for phospholipid head groups to move between membrane leaflets without disrupting the hydrophobic membrane interior. The specific structural features enabling this process remain poorly understood and represent an important area for future research using techniques such as cryo-electron microscopy or X-ray crystallography.

What potential therapeutic applications could arise from modulating PLSCR4 activity?

Modulating PLSCR4 activity shows promise for several therapeutic applications based on its roles in cellular processes and disease states:

  • Metabolic Disorders and Obesity: Given PLSCR4's role as a negative regulator of adipogenesis, enhancing its expression or activity could potentially inhibit excessive adipose tissue formation. This approach might be particularly valuable for treating conditions related to PTEN deficiency, where aberrant adipose tissue growth and lipoma formation are common manifestations . Therapeutic strategies could involve small molecules that enhance PLSCR4 expression or mimic its effects on the PI3K/AKT pathway.

  • Inflammatory Conditions: PLSCR4's protective role in acute respiratory distress syndrome (ARDS) suggests that upregulating its activity could alleviate inflammatory damage. By blocking pyroptosis through its effect on PS distribution and GSDMD pore formation, PLSCR4 activators could potentially reduce the severity of acute lung injury and other inflammatory conditions . This application is particularly relevant given the clinical challenge of treating ARDS, for which few effective interventions currently exist.

  • Viral Infections: The interaction between PLSCR4 and CD4 receptors, along with its binding to antiviral factors like SLPI, positions PLSCR4 as a potential target for antiviral strategies, particularly against HIV-1 . Compounds that modulate these interactions could potentially interfere with viral entry processes while preserving normal cellular functions.

  • Cancer Therapy: While not directly addressed in the provided search results, PLSCR4's connection to the tumor suppressor PTEN and the PI3K/AKT signaling pathway suggests potential applications in cancer treatment. Many cancers feature hyperactivation of PI3K/AKT signaling, and PLSCR4 modulators could provide an alternative approach to targeting this pathway.

Development of such therapeutics would require detailed structure-function studies of PLSCR4 and high-throughput screening approaches to identify molecules that specifically modulate its activity.

How can recombinant PLSCR4 be utilized as a research tool to study membrane dynamics?

Recombinant PLSCR4 represents a valuable research tool for investigating membrane dynamics and phospholipid organization across various biological systems:

  • Reconstitution Systems: Purified recombinant PLSCR4 can be incorporated into artificial membrane systems such as liposomes, supported lipid bilayers, or nanodiscs to study fundamental aspects of phospholipid scrambling. This approach allows precise control over membrane composition and protein concentration, enabling detailed kinetic and mechanistic studies of lipid translocation processes in isolation from other cellular factors .

  • Fluorescence-Based Assays: When combined with fluorescently labeled phospholipids (such as NBD-PS or rhodamine-labeled lipids), recombinant PLSCR4 enables real-time monitoring of phospholipid movement across membranes. These assays can be used to screen for compounds that modulate scramblase activity or to study the calcium-dependency of PLSCR4 function under various conditions .

  • Protein-Protein Interaction Studies: Recombinant PLSCR4 with appropriate tags (His, FLAG, GST) can be used in pull-down assays, surface plasmon resonance (SPR), or isothermal titration calorimetry (ITC) to identify and characterize novel binding partners. This application is particularly valuable for mapping interaction networks involving membrane-associated signaling complexes .

  • Cell-Based Functional Rescue: Recombinant PLSCR4 can be introduced into PLSCR4-deficient cells to perform rescue experiments, helping to establish causal relationships between PLSCR4 activity and specific cellular phenotypes. This approach has been particularly useful in discriminating between direct and indirect effects of PLSCR4 in complex biological processes like adipogenesis and inflammatory responses .

  • Antibody Generation and Validation: Purified recombinant PLSCR4 serves as an essential antigen for developing specific antibodies needed for immunodetection methods. Validated antibodies are crucial for studying endogenous PLSCR4 expression, localization, and post-translational modifications in various tissues and disease states .

These applications collectively enable researchers to dissect the complex roles of PLSCR4 in membrane biology and signaling pathways, potentially leading to novel insights into disease mechanisms and therapeutic opportunities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.