Recombinant Mouse Plasminogen receptor (KT)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Plgrkt; Plasminogen receptor; KT; Plg-R(KT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Plgrkt
Target Protein Sequence
MGFIFSKSMNENMKNQQEFMVTHARLQLERHLTMQNEMRERQMAMQIAWSREFLKYFGTF FGIATISLATGALKRKKPAFLVPIVPLSFIFTYQYDLGYGTLLQRMKSEAEDILETEKTK LELPKGLITFESLEKARREQSKLFSDK
Uniprot No.

Target Background

Function
The plasminogen receptor (Plg-R) is a receptor for plasminogen. It regulates urokinase plasminogen activator (uPA)-dependent and stimulates tissue-type plasminogen activator (tPA)-dependent cell surface plasminogen activation. It is believed to be part of a local catecholaminergic cell plasminogen activation system regulating neuroendocrine prohormone processing. Furthermore, it plays a role in inflammatory response regulation, influencing monocyte chemotactic migration and the activation of matrix metalloproteinases (MMPs), such as MMP2 and MMP9.
Gene References Into Functions
  1. Plg-R (KT) exhibited high expression in bovine adrenomedullary chromaffin cells, human pheochromocytoma tissue, PC12 pheochromocytoma cells, and murine hippocampus. PMID: 21795689
  2. Plg-R (KT) is crucial in plasminogen-dependent regulation of macrophage invasion, chemotactic migration, and recruitment during the inflammatory response. PMID: 21940822
Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein. Note=Colocalizes on the cell surface with urokinase plasminogen activator surface receptor/Plaur.
Tissue Specificity
Expressed in monocytes; detected in differentiated monocytes but not in progenitor cells. Expressed in adrenal medulla and hippocampus.

Q&A

What is Plg-RKT and how does it function in the plasminogen activation system?

Plg-RKT is a structurally unique transmembrane plasminogen receptor with both N- and C-terminal domains exposed on the extracellular face of the cell. It functions primarily by tethering plasminogen to cell surfaces through its C-terminal lysine residue, which significantly enhances plasminogen activation to plasmin . The plasminogen activation system itself is a versatile proteolytic system with essential functions in thrombolysis, extravascular fibrin surveillance, inflammation suppression, tissue remodeling, and regeneration . Unlike other plasminogen receptors, Plg-RKT is present exclusively on the cell surface as an integral membrane protein rather than being a redistributed intracellular protein .

How is Plg-RKT conserved across species and what implications does this have for research?

Plg-RKT is highly conserved across mammalian species with homologs also identified in Xenopus, Drosophila, and zebrafish . Importantly, all mammalian orthologs of Plg-RKT contain a C-terminal lysine residue, which is critical for its plasminogen binding function . This high degree of conservation suggests fundamental biological importance and enables comparative studies across model organisms. When designing experiments with recombinant mouse Plg-RKT, researchers should consider this evolutionary conservation as it may allow for cross-species functional analyses and potentially translational applications.

What tissues and cell types express Plg-RKT in mice?

Plg-RKT is broadly expressed in mammalian tissues and notably in many hematopoietic-derived cells . It shows particularly high expression in proinflammatory macrophages . In muscle tissue, Plg-RKT expression is significantly upregulated in satellite cells during caloric restriction conditions, with nearly 4-fold increase in protein expression compared to ad libitum feeding conditions . This expression pattern suggests tissue-specific regulation that should be considered when designing experiments targeting specific physiological contexts.

How are Plg-RKT knockout mice generated and what are their key phenotypes?

Plg-RKT knockout (Plg-RKT−/−) mice have been generated through a standard homologous recombination strategy in mouse embryonic stem cells . These mice exhibit several notable phenotypes:

  • Impaired macrophage recruitment (approximately 80% reduction in macrophage recruitment to the peritoneal cavity in the thioglycollate model)

  • Severe lactation defects that prevent nursing of offspring

  • Modest increase in dermatitis (though this may be influenced by the C57Bl/6 background strain's inherent susceptibility to dermatitis)

Importantly, Plg-RKT−/− mice are generally viable and phenotype-free in the absence of specific challenges, suggesting that pharmacological targeting of Plg-RKT in pathological contexts could be therapeutically viable .

What methods are optimal for detecting and quantifying Plg-RKT expression?

To effectively detect and quantify Plg-RKT expression, researchers can employ multiple complementary approaches:

  • Gene expression analysis: qRT-PCR can be used to measure Plg-RKT mRNA levels, as demonstrated in studies comparing satellite cells from ad libitum and caloric restricted mice .

  • Protein detection:

    • Western blotting using specific anti-Plg-RKT antibodies for protein quantification

    • Immunofluorescence on cultured cells to visualize cellular distribution

    • Flow cytometry (FACS) to analyze cell surface expression levels

When studying tissue-specific expression, it's important to isolate the specific cell population of interest rather than relying on whole-tissue analysis, as cell-specific changes may not be apparent in whole-tissue assays .

How can researchers effectively design experiments to study Plg-RKT-mediated plasminogen activation?

To study Plg-RKT-mediated plasminogen activation, researchers should consider the following experimental approaches:

  • Plasminogen binding assays: Overexpression of Plg-RKT increases cell surface plasminogen binding capacity, while genetic deletion decreases it . Comparing binding capacity between wild-type and Plg-RKT−/− cells can quantify the contribution of this receptor.

  • Plasminogen activation assays: Plg-RKT promotes plasminogen activation by both tissue-type plasminogen activator (t-PA) and urokinase plasminogen activator (u-PA) . Researchers can measure plasmin generation in the presence and absence of Plg-RKT.

  • Co-localization studies: Plg-RKT co-localizes and co-immunoprecipitates with the urokinase receptor (uPAR) . Immunofluorescence microscopy and co-immunoprecipitation experiments can reveal these interactions.

  • Functional blocking: Monoclonal antibodies against Plg-RKT can block plasminogen-dependent cell migration and pro-MMP activation, providing tools to assess functional significance .

How does Plg-RKT regulate leukocyte recruitment during inflammation?

Plg-RKT plays a critical role in leukocyte recruitment during inflammation through several mechanisms:

  • Cell migration promotion: Plg-RKT binds plasminogen and promotes its activation to plasmin on the surfaces of migrating monocytoid cells and lymphocytes . Anti-Plg-RKT monoclonal antibodies block plasminogen-dependent monocytoid cell migration through Matrigel and plasminogen-dependent chemotactic migration in response to CCL2 (MCP-1) .

  • MMP activation: In the thioglycollate-induced sterile peritonitis model, Plg-RKT is required for activation of pro-MMP-9 and pro-MMP-2 . Injection of anti-Plg-RKT monoclonal antibodies decreases pro-MMP-9 activation by 64% and pro-MMP-2 activation by 44% in peritoneal fluid .

  • Macrophage recruitment: Plg-RKT−/− mice show an approximately 80% reduction in macrophage recruitment to the peritoneal cavity in the thioglycollate model .

These findings indicate that Plg-RKT is a potential therapeutic target for inflammatory conditions where excessive leukocyte recruitment contributes to pathology.

What is the role of Plg-RKT in mammary gland development and lactation?

Plg-RKT plays a critical role in mammary gland development and lactation that appears to be both plasminogen-dependent and plasminogen-independent:

  • The lactation defect in Plg-RKT−/− mice is more severe than that observed in plasminogen knockout (Plg−/−) mice, suggesting plasminogen-independent mechanisms .

  • Possible mechanisms for Plg-RKT's role in mammary development include:

    • Serving as a receptor for an unidentified protease that modifies the extracellular matrix during mammary gland development

    • Working in concert with other cell surface or integral membrane proteins, potentially including β1 integrin or the gap junction protein connexin 43, which when deficient show similar mammary gland defects

This lactation incompetence in Plg-RKT−/− mice demonstrates that Plg-RKT is necessary for species survival, highlighting its fundamental biological importance beyond inflammation .

How does Plg-RKT mediate muscle stem cell expansion during caloric restriction?

Recent research has revealed an important role for Plg-RKT in muscle stem cell (satellite cell) expansion during caloric restriction (CR):

  • Receptor upregulation: CR increases Plg-RKT gene and protein expression specifically in satellite cells, with a nearly 4-fold increase in Plg-RKT protein in satellite cells from CR mice compared to ad libitum (AL) fed mice .

  • Signaling pathway: Plasminogen signals directly to muscle satellite cells through Plg-RKT to activate the ERK kinase pathway, promoting proliferation .

  • Functional effects:

    • Plasminogen treatment of satellite cells from CR mice produces a synergistic 2-fold increase in phospho-ERK (p-ERK)

    • CR increases satellite cell proliferation independent of plasminogen treatment, but shows a further 57% increase with plasminogen treatment

    • ERK inhibition negates the proliferative effects of both CR and plasminogen treatment

  • Gene expression changes: Plasminogen treatment of CR satellite cells induces robust expression of proliferation markers (Myf5, CyclinD1, and MyoD), which is ablated with ERK inhibition .

These findings reveal a novel liver-muscle endocrine axis where liver-secreted plasminogen signals to muscle satellite cells through Plg-RKT to promote stem cell expansion and muscle resilience during caloric restriction .

What are the plasminogen-independent functions of Plg-RKT?

Evidence suggests that Plg-RKT has important biological functions independent of plasminogen binding and activation:

  • Mammary gland development: The more severe lactation defect in Plg-RKT−/− mice compared to Plg−/− mice suggests plasminogen-independent roles . Plg-RKT may serve as a receptor for another protease or work with other membrane proteins like β1 integrin or connexin 43 .

  • Cell signaling: While Plg-RKT is known to promote ERK pathway activation in response to plasminogen in muscle satellite cells , it may also engage in other signaling networks independent of plasminogen.

  • Tissue homeostasis: The broad expression pattern of Plg-RKT across tissues suggests it may have undiscovered functions in maintaining tissue homeostasis beyond established roles in plasminogen activation .

Further research using Plg-RKT−/− mice in various physiological and pathological contexts will help elucidate these plasminogen-independent functions.

How might sex as a biological variable affect Plg-RKT function and research findings?

Sex-based differences in Plg-RKT function have been noted in research but are not extensively characterized. When designing studies involving Plg-RKT, researchers should consider:

  • Including both male and female animals in experimental designs to identify potential sex-based differences

  • Controlling for hormonal status when studying female animals, as reproductive hormones might influence Plg-RKT expression and function

  • Analyzing data by sex to identify potential sex-specific effects that might be masked in combined analyses

  • Considering sex as a variable when interpreting seemingly contradictory results from different studies

Understanding how sex influences Plg-RKT function could lead to more precise and personalized therapeutic approaches targeting this receptor in human disease contexts .

What potential roles does Plg-RKT play in pathological processes?

Plg-RKT has been implicated in several pathological processes that represent important areas for future research:

  • Inflammatory diseases: Given its role in macrophage recruitment and function, Plg-RKT may contribute to diseases where macrophages play key roles, including:

    • Neuroinflammatory diseases (via microglial cells)

    • Hepatotoxic injury (via Kupffer cells)

    • Obesity-related inflammation (via M1-type adipose tissue macrophages)

  • Cancer: Plg-RKT is upregulated in many tumor types and may contribute to cancer progression through:

    • Direct effects on tumor cells

    • Effects on tumor-promoting M2-type macrophages in the tumor microenvironment

  • Autoimmune conditions: Several plasminogen receptors are targets of autoantibody production in autoimmune diseases, suggesting Plg-RKT might also be involved in autoimmunity .

  • Fibrotic disorders: Given the role of plasmin in extracellular matrix remodeling, Plg-RKT may influence fibrotic processes in various tissues .

The viability of Plg-RKT−/− mice in the absence of specific challenges suggests that pharmacological targeting of this receptor in disease contexts could be a promising therapeutic strategy .

What are the best approaches for studying Plg-RKT-mediated cell migration?

To study Plg-RKT-mediated cell migration, researchers can employ several methodological approaches:

  • Transwell migration assays: Using Matrigel-coated transwells to assess plasminogen-dependent monocytoid cell migration. This can be performed with and without anti-Plg-RKT monoclonal antibodies to demonstrate receptor specificity .

  • Chemotactic migration assays: Assessing migration in response to specific chemoattractants like CCL2 (MCP-1) for monocytes. Again, compare conditions with and without Plg-RKT blocking .

  • In vivo migration models: The thioglycollate-induced peritonitis model provides an excellent system to study macrophage recruitment, with readouts including:

    • Peritoneal lavage cell counting and characterization

    • Flow cytometry analysis of recruited cell populations

    • Analysis of pro-MMP activation in peritoneal fluid

  • Genetic approaches: Compare migration in cells from wild-type versus Plg-RKT−/− mice, or use siRNA knockdown approaches in cell culture models .

These methods can reveal the contribution of Plg-RKT to specific migratory processes in both physiological and pathological contexts.

How can researchers investigate signaling pathways downstream of Plg-RKT?

To investigate signaling pathways downstream of Plg-RKT activation, researchers can use the following experimental approaches:

  • Phosphorylation analysis:

    • Western blotting for phosphorylated signaling proteins (e.g., p-ERK) after plasminogen treatment of cells expressing Plg-RKT

    • Comparison between cells from control and Plg-RKT−/− mice or cells with siRNA knockdown of Plg-RKT

    • Time-course experiments to determine activation kinetics

  • Pathway inhibitor studies:

    • Treat cells with specific pathway inhibitors (e.g., ERK inhibitor LY3214996) before plasminogen stimulation

    • Assess effects on downstream functional outcomes like proliferation or migration

  • Gene expression analysis:

    • qRT-PCR for pathway-specific target genes (e.g., Myf5, CyclinD1, MyoD for proliferation)

    • RNA-seq for unbiased identification of transcriptional changes

  • Functional readouts:

    • Measure proliferation (e.g., EdU incorporation) in conjunction with pathway manipulations

    • Assess cell migration or other functional outcomes relevant to the tissue context

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.