Recombinant Mouse Platelet-activating factor receptor (Ptafr)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant Mouse PAF-R

Recombinant mouse PAF-R retains the structural and functional properties of its native counterpart. Key features include:

  • Gene Structure: Encoded by Ptafr on mouse chromosome 4, sharing 99% amino acid identity with human PAF-R .

  • Expression Systems:

    • CHO-K1/PTAFR Stable Cell Line: Engineered to express mouse PAF-R, validated via calcium mobilization assays (EC₅₀ = 0.13 μM for PAF-induced signaling) .

    • Antibody Validation: Rabbit polyclonal antibodies (e.g., ab104162) detect recombinant PAF-R in Western blot (predicted 39 kDa band) and flow cytometry .

Research Applications and Key Findings

Recombinant mouse PAF-R has been pivotal in elucidating its roles in inflammation and cancer:

Inflammatory Modulation

  • Acute vs. Chronic Inflammation:

    • Topical application of carbamoyl-PAF (CPAF), a non-hydrolysable PAF mimetic, suppresses phorbol ester (PMA)-induced chronic inflammation and tumorigenesis in wild-type (WT) mice but not Ptafr⁻/⁻ mice .

    • CPAF reduces tumor incidence by 40% and shifts tumor size distribution toward smaller lesions .

ParameterWT MicePtafr⁻/⁻ MiceCPAF-Treated WT
Tumor Incidence80%95%60%
Tumors >5 mm35%55%15%
Myeloperoxidase (MPO) Activity12 U/mg22 U/mg8 U/mg

Immune Regulation

  • T Cell Priming: Blocking PAF-R during dendritic cell (DC) maturation enhances T cell proliferation (1.8-fold increase in CD4⁺ T cells) .

  • Regulatory T Cells (Tregs): Ptafr⁻/⁻ mice exhibit reduced splenic Treg frequency (4.2% vs. 7.5% in WT), linking PAF-R signaling to immune tolerance .

Downstream Pathways

  • Calcium Signaling: PAF binding triggers Gαq-mediated calcium flux, measurable via FLIPR assays in recombinant systems .

  • Cross-Talk with c-Kit: Mast cell-dependent anti-inflammatory effects of CPAF require functional c-Kit, as shown in c-Kitᴷⁱᵗ⁻/⁻ mice .

Interactions with Cytokines

  • TGF-β: PAF-R activation amplifies TGF-β production in lymph nodes during cigarette smoke-induced immunosuppression .

  • CXCL4/PF4: Recombinant CXCL4 inhibits angiogenesis (ED₅₀ = 2–10 μg/mL), a pathway modulated by PAF-R in endothelial cells .

Cancer Chemoprevention

  • Topical CPAF reduces squamous cell carcinoma (SCC) formation by 50% in DMBA/PMA-induced skin carcinogenesis models .

  • Mechanisms include suppression of granulocytic infiltrates (e.g., neutrophils) and MPO activity .

Inflammatory Diseases

  • Recombinant PAF-acetylhydrolase (rPAF-AH) inhibits airway hyperreactivity in murine asthma models, reducing eosinophil infiltration by 70% .

Assay Systems

  • Calcium Mobilization: Standardized using CHO-K1/PTAFR cells (EC₅₀ = 0.13 μM) .

  • Antibody Specificity: Anti-PAF-R antibodies (e.g., ab104162) require validation in membrane fractions (e.g., A549 cells) .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributor for specific delivery information.
Note: All protein shipments are standardly accompanied by normal blue ice packs. If you require dry ice shipping, please notify us in advance; additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specified tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Ptafr; Platelet-activating factor receptor; PAF-R; PAFr
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-341
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MEHNGSFRVDSEFRYTLFPIVYSVIFILGVVANGYVLWVFANLYPSKKLNEIKIFMVNLT MADLLFLITLPLWIVYYYNEGDWILPNFLCNVAGCLFFINTYCSVAFLGVITYNRYQAVA YPIKTAQATTRKRGISLSLIIWVSIVATASYFLATDSTNLVPNKDGSGNITRCFEHYEPY SVPILVVHVFIAFCFFLVFFLIFYCNLVIIHTLLTQPMRQQRKAGVKRRALWMVCTVLAV FIICFVPHHVVQLPWTLAELGYQTNFHQAINDAHQITLCLLSTNCVLDPVIYCFLTKKFR KHLSEKFYSMRSSRKCSRATSDTCTEVIVPANQTPIVSLKN
Uniprot No.

Target Background

Function
Platelet-activating factor receptor (PAFR) is a receptor for platelet activating factor, a chemotactic phospholipid mediator known for its potent inflammatory, smooth-muscle contractile, and hypotensive activities. It appears to mediate its actions through a G protein that activates a phosphatidylinositol-calcium second messenger system.
Gene References Into Functions
  1. Our research has identified PAF as a crucial inflammatory molecule involved in neuroinflammation, contributing to cerebral dysfunction during the acute phase of traumatic brain injury. PMID: 28094295
  2. PAFR plays a role in modulating the activation of NF-kappaB and in both pro- and anti-inflammatory responses during toll-like receptor activation in macrophages. PMID: 27554194
  3. This study demonstrates that tumor growth was reduced in PAFR knockout mice. PMID: 29445756
  4. Our findings in vitro confirm the above results in lipopolysaccharide (LPS)-incubated cardiomyocytes with or without PAFR expression. In conclusion, we suggest that inhibiting PAFR reduces inflammation, oxidative stress, and apoptosis, potentially offering a promising therapeutic strategy for alleviating myocardial I/R injury. PMID: 29278700
  5. PAFR null mutant mice exhibited improved functional recovery in grip and rotarod performance compared to wild-type mice. PMID: 26084439
  6. Our results indicate that CD36 and Platelet-Activating Factor Receptor are significant mediators of house dust mites (HDM) allergy development. Inhibition of HDM engagement with phosphorylcholine receptors in the lung provides protection against allergic airway disease. PMID: 28667161
  7. This study demonstrates that PAFR plays a significant role in Brucella abortus uptake as a promoter of phagocytosis, associated with JAK2 signaling activation. PMID: 27098179
  8. In the absence of PAFR signaling, monocytes and macrophages acquire a pro-inflammatory phenotype, leading to adipose tissue inflammation and metabolic dysfunction. PMID: 26785675
  9. Data, including findings from knockout mice, suggest that signal transduction via platelet-activating factor (PAF) and PAF receptor is involved in regulating lipid metabolism and inflammation in the liver of mice on a high-refined carbohydrate diet. PMID: 26013469
  10. ExoU activates NF-kappaB through PAFR signaling, which in turn enhances PAFR expression, highlighting a critical mechanism for amplifying the response to this P. aeruginosa toxin. PMID: 24612488
  11. In PAF receptor-knockout mice, diet-induced obesity is exacerbated. PMID: 25577975
  12. Bacteria did not associate with PAFR, indicating an indirect role of PAFR in pneumococcal adhesion to endothelial cells. PMID: 24841255
  13. PAFR deficiency resulted in reduced inflammation in adipose tissue and improved glucose homeostasis in mice fed a high-carbohydrate diet. PMID: 24339378
  14. PAFR and CD36 coimmunoprecipitated with flotillin-1, a constitutive lipid raft protein, and disruption of these membrane microdomains by methyl-beta-cyclodextrin reduced apoptotic cell phagocytosis. PMID: 24347838
  15. Our findings establish the existence of a functional partnership between PAF-R and eNOS on the endothelial cell plasma membrane. PMID: 24086643
  16. PAFR signaling contributes to a pro-inflammatory environment in the model of obstructive nephropathy, promoting the fibrotic process. PMID: 24492283
  17. This study proposes for the first time that PAF/PAF-R can mediate dopaminergic degeneration through an NF-kappaB-dependent signaling process. PMID: 23743065
  18. EfLTA induces the expression of chemokines via signaling pathways involving TLR2 and PAFR, distinct from that of LPS-induced chemokine expression. PMID: 23964117
  19. Blockade of the platelet-activating factor receptor may contribute to the progression of periodontal disease triggered by Aggregatibacter actinomycetemcomitans by directly affecting osteoclast differentiation and activity. PMID: 24002061
  20. Therefore, PAFR activation is crucial in the pathogenesis of pulmonary damage associated with Plasmodium berghei ANKA strain infection in C57Bl/6 mice. PMID: 23260771
  21. Recognition of apoptotic cells by phagocytes leads to activation of PAFR pathways, creating a microenvironment conducive to melanoma growth. PMID: 22577252
  22. PAFR may play a role in tumor response mechanisms, such as stress responses triggered by chemotherapeutic agents. PMID: 22570511
  23. PAFR on donor leukocytes plays a critical role in GVHD by mediating leukocyte influx and cytokine production in target tissues. PMID: 22301794
  24. Our findings suggest that PAFR acts to suppress PMA-induced chronic inflammation and to suppress neoplastic development in response to chemical carcinogens. PMID: 22223848
  25. The absence of the PAF receptor results in a milder form of experimental autoimmune encephalomyelitis, characterized by altered types of inflammatory mediators and infiltrating cells in central nervous system (CNS) tissue. PMID: 21338585
  26. PAFR is a disease-associated gene and plays a significant role in driving neutrophil influx and lung damage after infection of mice with two subtypes of Influenza A. PMID: 21079759
  27. PAF-R-dependent pathways are activated during experimental tumor growth, modifying the microenvironment and the phenotype of tumor macrophages in a way that promotes tumor growth. PMID: 20465821
  28. Our results reveal that certain strains of Gram-positive bacteria exploit hypoxia-inducible factor 1 alpha-regulated platelet-activating factor receptor as a mechanism for translocation through intestinal epithelial cells. PMID: 20032301
  29. The degradation of platelet-activating factor (PAF) was examined by incubating PAF with macrophages from PAF receptor-deficient mice. PMID: 11786559
  30. The PAF receptor senses cellular damage through the recognition of PAF and/or PAF-like molecules, such as oxidized phosphatidylcholine. This activation triggers cytokine transcription and induces systemic immune suppression. PMID: 11805144
  31. Embryonic PAF does not appear to regulate the expression of its own receptor in vitro. PMID: 11958508
  32. These studies firmly establish a role for PAFR activation in the local, remote, and systemic inflammatory injury and lethality that follows reperfusion of the ischemic superior mesenteric artery. PMID: 12812996
  33. Our results align with the hypothesis that activation of PAF receptors controls T. cruzi replication largely by facilitating the uptake of the parasite and subsequent activation of macrophages. PMID: 12850205
  34. PAFR-deficient mice exhibited relative resistance to pneumococcal pneumonia. PMID: 14767826
  35. Mice deficient in the cell surface receptor for PAF (PAFR-/-), a bioactive mediator of oxidative stress and inflammation, are protected from the spatial reference learning deficits associated with intermittent hypoxia during sleep. PMID: 15030403
  36. PAFR expression and/or function underlies critical components of intermittent hypoxia-induced long-term ventilatory facilitation, but does not play a role in potentiating the hypoxic ventilatory response after exposures. PMID: 15087283
  37. In organ cultures, bone resorption was significantly suppressed by treatment with a PAF receptor antagonist or genetic PAF receptor deficiency. PMID: 15232615
  38. PAFR does not interfere with the clearance of nontypeable Haemophilus influenzae from the respiratory tract. PMID: 15545826
  39. Pneumococcus utilizes the PAFR, leading to severe pneumonia in a host previously exposed to influenza A. PMID: 16100290
  40. UVB photo-oxidizes cellular phospholipids, creating PAF analogs that stimulate the PAF receptor to induce further PAF synthesis and apoptosis. PMID: 16115894
  41. The association of beta-arrestin with the platelet-activating factor receptor contributes to successful translocation of pneumococci. PMID: 16299272
  42. Platelet activating factor (PAF) receptor is involved in mediating gram-negative bacterial uptake associated with transcytosis in isolated murine intestinal segments. PMID: 16369019
  43. PAF is involved in the pathogenesis of folic acid-induced renal injury by activating neutrophils in the acute phase and macrophages in chronic interstitial fibrosis. Inhibiting the PAF pathway may be therapeutic for kidney injury from inflammatory cells. PMID: 16651609
  44. PAFR mediates early impairment of neutrophil migration towards the infectious focus during lethal sepsis caused by cecum ligation and puncture in mice. PMID: 16818786
  45. PAFr guides phosphorylcholine-containing bacterial components, such as the cell wall, into host cells, where the response ranges from quiescence to severe pathophysiology. PMID: 17056547
  46. We conclude that PAFr plays a significant role in hypersusceptibility to pneumococcal infection in sickle cell disease. PMID: 17230418
  47. The enhanced in vitro adherence of pneumococci to respiratory epithelium observed following incubation with influenza virus is not solely mediated by PAFR (platelet-activating factor receptor). PMID: 17852951
  48. Epidermal PAF-R can modulate UVB-mediated early gene expression. PMID: 17928889
  49. Deficiency of the platelet-activating factor receptor significantly diminishes acute lung inflammation induced by bacterial lipoteichoic acid in vivo. PMID: 18292574
  50. The platelet-activating factor receptor and serotonin receptor may play roles in photocarcinogenesis. PMID: 18483284

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Found in a range of organs. Expressed most strongly in spleen, followed by skeletal muscle, lung and small intestine. Expressed at moderate levels in the heart. Expressed at relatively low levels in the brain, liver and kidney.

Q&A

What is the structural characterization of mouse Ptafr?

Mouse Ptafr belongs to the class A rhodopsin-like G-protein coupled receptor (GPCR) family. The receptor exhibits approximately 58% protein sequence identity compared to human PAFR, with significantly higher conservation (80-90%) within transmembrane domains 2, 3, and 7 . Mouse Ptafr contains the characteristic seven hydrophobic α-helical domains common to rhodopsin family GPCRs and features several conserved amino acid motifs including:

  • Asparagine (N) in the first transmembrane domain

  • Aspartate (D) in the second and seventh transmembrane domains

  • LXXXD motif in the second transmembrane domain

  • Tryptophan (W) in the fourth transmembrane domain

  • Conserved cysteine (C) residues in the first two extracellular loops

  • FXP motif in the sixth transmembrane domain

  • DPXXY motif in the seventh transmembrane domain

Unlike many GPCRs that contain the DRY motif at the end of the third transmembrane domain (important for G-protein coupling), mouse Ptafr contains an NRF sequence at this position. The receptor also contains two conserved predicted sites for N-linked glycosylation and multiple threonine/serine residues that serve as potential phosphorylation sites for protein kinases A, G, and C .

How does Ptafr mediate inflammatory responses?

Ptafr mediates inflammatory responses through several mechanisms:

  • Acute inflammation promotion: Upon binding platelet-activating factor (PAF), Ptafr initiates signaling cascades that promote vasodilation, increased vascular permeability, platelet aggregation, bronchoconstriction, and alterations in leukocyte function .

  • Leukocyte modulation: Ptafr activation affects multiple leukocyte functions including mast cell activation and migration, mononuclear and neutrophilic phagocytosis, and M2 polarization of macrophages .

  • Complex immunomodulation: Beyond its pro-inflammatory effects, Ptafr signaling demonstrates important immunoregulatory functions. For example, Ptafr-deficient mice (Ptafr-/- mice) show increased cutaneous tumorigenesis and enhanced chronic inflammation in response to phorbol ester application, suggesting that Ptafr signaling may also suppress certain inflammatory responses .

  • Macrophage reprogramming: PAF can reprogram macrophages to enhance cytokine responses to subsequent endotoxin stimulation, acting as an autocrine mediator of macrophage activation following lipopolysaccharide (LPS) challenge via tumor necrosis factor alpha (TNF-α) expression .

How is Ptafr expression regulated in mouse cells?

Ptafr expression undergoes dynamic regulation in response to various stimuli:

  • Ligand-induced downregulation: Upon binding PAF, Ptafr undergoes rapid downregulation through receptor phosphorylation, internalization, and partial degradation. This represents a negative feedback mechanism that creates a refractory state following receptor activation .

  • Inflammatory mediator effects: Exposure to LPS and bacterial components can modulate Ptafr expression at both protein and gene levels. For example, in bone marrow-derived macrophages (BMDM), LPS treatment affects both Ptafr and PAF-synthesizing enzyme (LPCAT2) expression .

  • Tissue-specific expression: Ptafr is expressed in various tissues with different baseline levels, including keratinocytes, macrophages, and mast cells, allowing tissue-specific responses to PAF .

  • Antagonist effects: PAFR antagonists like PCA 4248 can block the receptor downregulation induced by exogenous PAF, preventing the loss of receptor from the cell surface .

What are the phenotypic characteristics of Ptafr-deficient mice in carcinogenesis models?

Ptafr-deficient (Ptafr-/-) mice exhibit several surprising phenotypic characteristics in carcinogenesis models:

  • Enhanced tumorigenesis: Contrary to what might be expected from PAF's pro-inflammatory reputation, Ptafr-/- mice show increased susceptibility to cutaneous tumorigenesis when subjected to two-stage chemical carcinogenesis protocols (DMBA/PMA). This suggests PAF-Ptafr signaling may have tumor-suppressive effects .

  • Exaggerated chronic inflammation: Ptafr-/- mice demonstrate enhanced chronic inflammatory responses to repetitive phorbol ester (PMA) applications. This manifests as increased epidermal thickness and elevated myeloperoxidase (MPO) activity, indicating enhanced neutrophil infiltration .

  • Altered tumor spectrum: Histopathological analysis of tumors from Ptafr-/- mice shows differences in tumor types compared to wild-type controls, with potentially more aggressive phenotypes observed in the knockout mice .

  • PAF agonist effects: When wild-type mice are treated with the PAF-mimetic carbamoyl-PAF (CPAF), they show significant reduction in both acute and chronic PMA-induced inflammation, as well as decreased chemical carcinogenesis—effects that are absent in Ptafr-/- mice .

These findings suggest a complex role for Ptafr in regulating chronic inflammation and cancer development that contradicts its typical characterization as purely pro-inflammatory.

How do the anti-inflammatory effects of Ptafr activation depend on c-Kit?

The anti-inflammatory effects of Ptafr activation show a critical dependence on c-Kit, suggesting an important role for mast cells:

  • c-Kit requirement: CPAF (a PAF mimetic) fails to suppress PMA-induced inflammation in c-Kit-deficient (c-Kit W-sh/W-sh) mice, indicating that c-Kit expression is necessary for the anti-inflammatory effects of PAF-Ptafr signaling .

  • Mast cell involvement: Given that c-Kit is highly expressed on mast cells and is critical for their development and function, these findings suggest mast cells may be the key cellular mediators of PAF's immunomodulatory effects .

  • Immunosuppressive mechanisms: Previous research has shown that mast cells can suppress chronic inflammation and adaptive immune responses. In particular, mast cells limit contact hypersensitivity and chronic UVB-induced inflammation, providing a possible mechanism for PAF's immunomodulatory effects .

  • Lymph node migration: PAF-R-dependent migration of mast cells to lymph nodes has been observed in UVB-induced immunosuppression, where they exert an interleukin (IL)-10-dependent immunosuppressive effect. A similar mechanism may be at work in the response to PMA-induced inflammation .

What methodological considerations are important when using recombinant mouse Ptafr in cell-based assays?

When designing experiments using recombinant mouse Ptafr in cell-based assays, researchers should consider:

  • Receptor downregulation kinetics: Following activation by PAF, Ptafr undergoes rapid downregulation. Experimental timelines should account for this dynamic change in receptor expression, which can significantly impact downstream readouts. Typically, measurable downregulation occurs within 2 hours of PAF exposure .

  • Appropriate antagonist controls: PAFR antagonists such as PCA 4248 and WEB 2086 (Apafant) should be included as controls to confirm specificity of observed effects. These antagonists can block PAF-induced receptor downregulation without affecting baseline receptor expression .

  • Detection method validation: When assessing Ptafr expression, multiple detection methods (e.g., immunofluorescence, western blotting, and flow cytometry) should be used for validation. Commercially available antibodies should be tested for cross-reactivity with mouse Ptafr before use .

  • Signaling pathway inhibitors: Experiments should incorporate specific inhibitors targeting downstream signaling components (e.g., PI3K/Akt inhibitor wortmannin or calcium calmodulin kinase II inhibitor KN62) to dissect the signaling pathways mediating observed effects .

How do PAF concentration and exposure time influence experimental outcomes?

The concentration of PAF and duration of exposure significantly impact experimental outcomes:

  • Dose-dependent edema response: Topical application of CPAF (a non-hydrolysable PAF mimetic) induces a dose-dependent edema response in wild-type mice that is absent in Ptafr-/- mice, indicating a direct relationship between PAF concentration and acute inflammatory responses .

  • Temporal effects: PAF induces short-lived acute inflammatory responses but can have paradoxical effects on chronic inflammation. For example, co-administration of CPAF with PMA decreases both acute ear thickness changes and sustained inflammation associated with chronic PMA applications .

  • Receptor desensitization threshold: The concentration of PAF required to induce receptor desensitization may differ from that needed for signaling activation. Research has shown that 10 μM PAF treatment for 2 hours is sufficient to induce significant PAFR downregulation in bone marrow-derived macrophages .

  • Cell type-specific sensitivity: Different cell types may exhibit varying sensitivity to PAF concentrations, requiring optimization for each experimental system. Macrophages and endothelial cells, for instance, may respond differently to the same PAF concentration .

What controls are essential when working with Ptafr knockout models?

When designing experiments with Ptafr knockout models, several essential controls should be included:

  • Age and sex-matched wild-type controls: Use age (8-12 weeks) and sex-matched wild-type mice of the same background strain (e.g., C57BL/6 for Ptafr-/- mice derived from this background) to account for strain and age-related differences in inflammatory responses .

  • PAF receptor agonist validation: Include experimental groups treated with PAF receptor agonists (e.g., CPAF) to confirm that observed phenotypic differences between wild-type and knockout mice are specifically due to the absence of PAF signaling .

  • PAF receptor antagonist controls: Administer PAF receptor antagonists to wild-type mice to pharmacologically mimic the knockout condition and confirm that observed effects are receptor-dependent rather than due to developmental compensations in knockout mice .

  • Cell type-specific phenotyping: Since PAF affects various cell types differently, comprehensive phenotyping of immune cell populations (particularly mast cells, given their relationship with c-Kit and PAF-mediated effects) should be performed in both knockout and wild-type mice .

What techniques are most effective for detecting Ptafr expression and activation?

Multiple complementary techniques should be employed to effectively detect Ptafr expression and activation:

  • Immunofluorescence microscopy: Enables visualization of Ptafr cellular localization and can detect changes in expression following ligand binding. This technique has successfully demonstrated PAFR downregulation after PAF treatment in bone marrow-derived macrophages .

  • Flow cytometry: Provides quantitative assessment of Ptafr expression levels across cell populations. Flow cytometric analysis has shown approximately 23% of bone marrow-derived macrophages express PAFR, with detectable changes in mean fluorescence intensity following PAF exposure .

  • Western blotting: Allows detection of Ptafr protein levels and can confirm receptor degradation following activation. This technique has verified that PAFR is partially degraded upon PAF binding and that antagonists like PCA 4248 can block this phenomenon .

  • qRT-PCR: Measures Ptafr gene expression levels and can detect transcriptional changes in response to stimuli. This approach has been used to assess PAFR/PTAFR gene expression changes in macrophages stimulated with PAF, LPS, or bacterial components .

How can researchers distinguish between direct and indirect effects of Ptafr signaling?

Distinguishing between direct and indirect effects of Ptafr signaling presents a significant challenge. Researchers should employ multiple approaches:

  • Temporal analysis: Monitor the kinetics of responses following Ptafr activation. Direct effects typically occur rapidly (minutes to hours), while indirect effects mediated by secondary messengers or altered gene expression develop more slowly (hours to days) .

  • Cell-specific knockouts: Utilize conditional Ptafr knockout models targeting specific cell populations (e.g., macrophage-specific or mast cell-specific Ptafr deletion) to determine which effects are mediated directly by Ptafr on those cells versus indirectly through intercellular communication .

  • Ex vivo and in vitro validation: Compare in vivo findings with ex vivo and in vitro systems where cellular composition is more controlled. This helps identify which effects require the complex multicellular environment of intact tissues .

  • Signaling pathway inhibitors: Use selective inhibitors targeting downstream signaling components (e.g., wortmannin for PI3K/Akt or KN62 for CaMK II) to determine which pathways mediate specific Ptafr-dependent effects .

How should researchers interpret contradictory findings between acute and chronic inflammation models?

The contradictory findings between acute and chronic inflammation models reflect Ptafr's complex role in immune regulation:

  • Contextual interpretation: Recognize that PAF can promote acute inflammation while simultaneously limiting chronic inflammatory responses. This apparent contradiction may reflect evolutionarily conserved negative feedback mechanisms that prevent excessive or prolonged inflammation .

  • Cell type-specific effects: Consider that PAF may have different effects on distinct cell populations. For example, while PAF directly activates mast cells and neutrophils to promote acute inflammation, it may also trigger compensatory anti-inflammatory pathways in mast cells that limit chronic inflammation .

  • Temporal resolution: Employ time-course studies to distinguish between early pro-inflammatory and delayed anti-inflammatory effects. This approach can reveal biphasic responses that might otherwise appear contradictory when measured at single time points .

  • Dose-dependent effects: Recognize that PAF may exert opposing effects at different concentrations. Low PAF levels might prime immune cells for enhanced responses, while high concentrations might trigger negative feedback mechanisms and suppression .

What factors could explain differences between in vitro and in vivo Ptafr studies?

Several factors can explain discrepancies between in vitro and in vivo Ptafr studies:

  • Microenvironmental complexity: In vivo systems contain diverse cell types that interact in complex networks, allowing for indirect effects of Ptafr signaling that cannot be fully recapitulated in vitro. For example, the anti-inflammatory effects of PAF in vivo may depend on mast cell migration to lymph nodes, a process impossible to model in simple cell culture systems .

  • PAF metabolism: In vivo, enzymatic degradation by PAF acetylhydrolase (PAF-AH) regulates PAF bioavailability. This regulation is often absent in vitro unless specifically incorporated into experimental design .

  • Receptor dynamics: Ptafr undergoes complex regulation in vivo, including desensitization, internalization, and degradation, which may differ in vitro due to altered receptor trafficking or recycling machinery .

  • Compensatory mechanisms: Chronic Ptafr deficiency in knockout models may trigger compensatory changes during development that are not present in acute receptor inhibition studies in vitro, potentially explaining contradictory outcomes between these approaches .

How does the genetic background of mouse models influence Ptafr research outcomes?

Genetic background significantly impacts Ptafr research outcomes through several mechanisms:

  • Strain-dependent inflammation: Different mouse strains exhibit variable baseline inflammation levels and responses to inflammatory stimuli. For example, studies often use C57BL/6 mice as the background for Ptafr-/- models, but findings might differ in other genetic backgrounds .

  • Modifier genes: Strain-specific genetic modifiers can influence PAF production, Ptafr expression, or downstream signaling efficacy. These modifiers may explain inconsistent findings across laboratories using nominally identical models but different background strains .

  • Mast cell populations: Given the importance of mast cells in mediating PAF's immunomodulatory effects, strain differences in mast cell numbers, distribution, or phenotype could significantly impact experimental outcomes. This is particularly relevant when comparing results between C57BL/6 mice and other strains with different mast cell characteristics .

  • Experimental validation: To address this variable, researchers should validate key findings across multiple genetic backgrounds or use congenic strains where the mutation of interest has been backcrossed onto different background strains for several generations .

What are promising applications of Ptafr modulators in disease models?

Several promising applications for Ptafr modulators emerge from recent research:

  • Cancer chemoprevention: The finding that CPAF application suppresses chemical carcinogenesis suggests that Ptafr agonists could have cancer chemopreventive activity, particularly for skin cancers. This represents a paradoxical but potentially valuable application of Ptafr modulation .

  • Chronic inflammation management: The ability of PAF-Ptafr signaling to suppress PMA-induced chronic inflammation suggests Ptafr agonists might help manage specific types of chronic inflammatory conditions, particularly those involving aberrant epithelial inflammation .

  • Balanced immunomodulation: Rather than complete Ptafr blockade, targeted modulation that preserves beneficial anti-inflammatory effects while inhibiting detrimental acute inflammation could offer advantages over current approaches .

  • Mast cell-directed therapies: Given the dependence of PAF's anti-inflammatory effects on c-Kit (suggesting mast cell involvement), developing therapies that specifically target PAF-mast cell interactions might provide novel approaches to inflammatory disease management .

What technological advances would enhance Ptafr research quality?

Several technological advances would significantly enhance Ptafr research quality:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.