Recombinant Mouse Polycystic kidney disease 2-like 2 protein (Pkd2l2)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Classification

Pkd2l2 is a transmembrane protein classified under the TRPP (TRP polycystic) subfamily, which includes channels like polycystin-2 (PKD2) and PKD2L1 . Key structural features include:

  • Multiple transmembrane domains: Similar to other TRP channels, Pkd2l2 contains pore-loop structures critical for ion conduction .

  • Cytoplasmic regions: N- and C-terminal domains that may mediate protein interactions or regulatory functions .

  • Evolutionary conservation: Found in organisms ranging from yeast to mammals, suggesting a conserved role in cellular homeostasis .

FeatureDetails
Gene LocationChromosome 5 in humans (NC_000005.10)
Protein Length~1,200 amino acids (estimated from homology to PKD2)
Functional DomainsTransmembrane helices, pore-forming regions, cytoplasmic interaction motifs

Functional Properties

As a TRPP channel, Pkd2l2 is hypothesized to regulate cation transport, including Ca²⁺, Na⁺, or K⁺, though direct evidence remains limited. Key insights include:

  • Ion selectivity: Similar to PKD2, which exhibits nonselective cation permeability with a preference for Ca²⁺ .

  • Gating mechanisms: May respond to extracellular stimuli, such as mechanical stress or ligand binding, though specific triggers are uncharacterized .

  • Subcellular localization: Likely localized to plasma membranes or intracellular compartments, based on TRP family characteristics .

Tissue Expression and Localization

Pkd2l2 is expressed across multiple tissues, as inferred from mouse models and human gene expression databases :

TissueObserved ExpressionBiological Role
KidneyDetoxification, electrolyte balancePotential role in cyst formation regulation
Nervous SystemIon homeostasis, synaptic signalingModulation of neuronal excitability
LiverMetabolism, bile secretionHepatic ion transport regulation
Adipose TissueEnergy metabolism, adipocyte functionLink to metabolic disorders
Reproductive OrgansSperm maturation, oocyte developmentFertility-related ion transport

Research Applications and Recombinant Forms

Recombinant Pkd2l2 is used in biochemical and cellular assays to study its function, interactions, and therapeutic potential .

Available Recombinant Products

Product TypeReactivitySourceApplicationsVendor
Fc-Fusion ProteinMouseHEK293 cellsELISA, Western blot, interaction studiesKerafast , Antibodies-Online
Cell-Free SynthesizedHuman/MouseIn vitro expressionStructural studies, antibody validationAntibodies-Online

Experimental Uses

  • Protein interaction studies: Identifying binding partners using co-IP or pull-down assays .

  • Ion channel activity assays: Electrophysiology to measure cation permeability .

  • Disease modeling: Investigating its role in kidney cysts or metabolic disorders .

Clinical and Therapeutic Relevance

While Pkd2l2 is not directly implicated in ADPKD (unlike PKD2), its homology to TRPP channels suggests potential roles in:

  • Kidney disease: Modulating cyst formation or epithelial ion transport .

  • Neurological disorders: Dysregulation of neuronal ion homeostasis .

  • Cancer: TRP channels are often aberrantly expressed in tumors, though Pkd2l2’s role is unexplored .

Data Gaps and Future Directions

  • Functional characterization: Direct evidence of ion channel activity in native or recombinant systems.

  • Disease association: Linking Pkd2l2 mutations to human pathologies.

  • Therapeutic targeting: Developing modulators of Pkd2l2 for ion channelopathies.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preference in the order notes section, and we will prepare the product accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: Our proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing should be avoided. For short-term storage, working aliquots can be kept at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Repeated freeze-thaw cycles should be minimized.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type is determined during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Pkd2l2; Polycystic kidney disease 2-like 2 protein; Polycystin-2L2; Polycystin-L2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-621
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Pkd2l2
Target Protein Sequence
MSEATWWYRGGTSKHDLHYRREAEVNTTLEELLLYFIFLINLCILTFGMVNPHMYYLNKV MSSLFVDTSLPDDERSSFRSIRSITEFWKFMEGPLIDGLYWDSWYGNKQLYSVKNSSRIY YENVLLGIPRVRQLRVRNNTCKVYPAFQSLVSDCYSKYTVENEDFSDFGLKRNPEWTHTP SSRTAPWHWGFVGVYRDGGYIVTLSKSKSETKAKFVDLRLNNWISRGTRAVFIDFSLYNA NVNLFCIIRLLAEFPATGGLLTSWQFYSVKLLRYVSYYDYFIASCEVIFCIFLFVFIIQE LRKVNEFKSAYFRSVWNWLEMLLLLLCFLAVSFYAYCNMQSFLLLGQLLKNTDSYPDFYF LAYWHIYYNNVIAITIFFAWIKIFKFISFNETMSQLSSTLSRCMKDIVGFAIMFFIIFSA YAQLGFLVFGSQVDDFSTFQNSIFAQFRIVLGDFNFAGIQQANWILGPIYFITFIFFVFF VLLNMFLAIINDTYSEVKADYSIGRRPDFELGKIIQKSCFNVLEKLRLKKAQAKEEKKMQ TTDLAQRARRDGFDESEIQEAEQMKRWKERLEKKYYSTEIQDDYQPVTQQEFRELFLYAV ELEKELHYVSLKLNQLMRKLH
Uniprot No.

Target Background

Function
Polycystic kidney disease 2-like 2 (Pkd2l2) may function as a subunit of a cation channel and play a role in fertilization.
Gene References Into Functions
  1. All channel-forming isoforms of TRPP channels (polycystin-2, polycystin-L, and polycystin-2L2) were expressed in adult mouse lacrimal gland. PMID: 21508103
  2. Pkd2l2 may be involved in the mid-late stage of spermatogenesis through modulation of the intracellular calcium concentration. PMID: 18670078
Database Links
Protein Families
Polycystin family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed only in testis and heart.

Q&A

What is Pkd2l2 and how does it relate to other polycystin family proteins?

Pkd2l2 (Polycystic kidney disease 2-like 2 protein) is a member of the polycystin family, also known as Polycystin-2L2 or Polycystin-L2. It shares structural similarities with other polycystin proteins, particularly PKD2 (Polycystin-2), which forms homotetrameric ion channels. The full-length mouse Pkd2l2 protein consists of 621 amino acids and is encoded by the Pkd2l2 gene. The protein has a Uniprot identification number of Q9JLG4 .

Unlike PKD2, which has been extensively characterized through cryo-EM studies revealing its structure as a homotetrameric ion channel, the detailed structure of Pkd2l2 has not been as thoroughly elucidated. PKD2's structure shows a voltage-sensor domain with two of four gating charges typically found in voltage-gated ion channels, and an ion permeation pathway constricted at the selectivity filter . Studies of related polycystin proteins suggest Pkd2l2 may share similar structural features with variations in specific domains.

What are the optimal storage and handling conditions for recombinant Pkd2l2 protein to maintain functionality?

Recombinant Pkd2l2 protein requires specific storage and handling protocols to maintain its structural integrity and functionality for experimental use. For long-term storage, the protein should be kept at -20°C or -80°C in a Tris-based buffer containing 50% glycerol that has been optimized for this specific protein .

For experimental work, it is recommended to prepare small working aliquots and store them at 4°C for up to one week to minimize freeze-thaw cycles, as repeated freezing and thawing can compromise protein integrity. When thawing frozen protein, gentle handling is essential - the protein should be thawed on ice or at 4°C rather than at room temperature to prevent denaturation of temperature-sensitive domains. Before use in assays, the recombinant protein should be centrifuged at low speed to remove any potential aggregates, and concentration should be verified using standard protein quantification methods such as Bradford or BCA assays.

How can researchers validate the authenticity and activity of recombinant Pkd2l2 protein?

Validating recombinant Pkd2l2 requires a multi-faceted approach focusing on both protein identity and functional activity. For identity confirmation, Western blotting using antibodies specific to Pkd2l2 or to the tag incorporated during production is standard practice. Additionally, mass spectrometry analysis can verify protein identity by matching peptide fragments to the expected sequence (MSEATWWYRG... through ...EKLRLKKAQAKEEKKMQ as documented in product specifications) .

For functional validation, electrophysiology techniques similar to those used for PKD2 characterization can assess channel activity. When analyzing Pkd2l2 channel properties, it's critical to include appropriate controls such as non-transfected cells to establish baseline currents, as has been noted in PKD2 research where distinguishing channel-specific activity from background conductance can be challenging . Additional validation can include using known TRP channel blockers (gadolinium, ruthenium red) to confirm channel-specific currents, and characterizing basic properties such as reversal potentials and ion selectivity to verify that the observed activity matches expected Pkd2l2 behavior.

How do mutations in the cholesterol-binding domain of Pkd2l2 affect its ciliary localization compared to other polycystin proteins?

The localization of polycystin proteins to primary cilia is critical for their function, with disruption of this localization linked to polycystic kidney disease. Research on polycystin-2 (PC2) has identified a critical cholesterol-binding site (L517) that when mutated (L517R) impairs ciliary localization without affecting channel function . For researchers studying Pkd2l2, comparative analysis with PC2 suggests potential parallels in cholesterol-dependent localization.

To investigate Pkd2l2 cholesterol binding domains, researchers should employ a systematic approach:

  • Sequence alignment of Pkd2l2 with PC2 to identify potential conserved cholesterol-binding motifs

  • Site-directed mutagenesis of candidate binding sites

  • Fluorescence localization studies using tagged Pkd2l2 constructs in ciliated cells

  • Cholesterol depletion/supplementation experiments to assess localization dependency

What are the electrophysiological properties of Pkd2l2 channels and how do they differ from other TRP family channels?

The electrophysiological characterization of Pkd2l2 channels presents significant technical challenges but offers critical insights into their functional properties. Unlike some better-characterized TRP channels, Pkd2l2 channels typically generate small current amplitudes (in the pA/pF range), necessitating high-sensitivity recording equipment and careful control experiments .

To properly characterize Pkd2l2 electrophysiologically, researchers should implement:

  • Whole-cell patch clamp recordings in heterologous expression systems

  • Single-channel recordings in lipid bilayers or excised patches

  • Comparative analysis with established TRP channel blockers

  • Ion substitution experiments to determine selectivity

When interpreting results, researchers should be aware of recent findings suggesting that related proteins like PC2 may not form active channels in certain heterologous systems like HEK cells . Special attention should be paid to distinguishing Pkd2l2-specific currents from endogenous conductances, which can be accomplished by including non-transfected control recordings and using specific channel blockers.

The unique voltage-sensing domain structure of polycystin channels, which in PKD2 retains only two of the four gating charges typically found in voltage-gated channels , suggests that Pkd2l2 may display distinctive voltage-dependent properties that differ from classical voltage-gated channels. Researchers should specifically examine:

PropertyMethodExpected Pkd2l2 CharacteristicsComparison to Other TRP Channels
Voltage-dependenceStep protocolsWeak voltage dependenceLess pronounced than TRPV1/TRPM8
SelectivityIon substitutionCation selective (predicted)Similar to PC2 but distinct from TRPV5/6
ConductanceSingle channelLow conductance (predicted)Lower than TRPA1/TRPV1
PharmacologyChannel blockersSensitive to lanthanides (predicted)Similar to PC2/TRPP channels

How does the 3D structure of Pkd2l2 differ from the cryo-EM structure of PKD2, and what are the functional implications?

While the cryo-EM structure of PKD2 has been determined at 3.0 Å resolution, establishing it as a homotetrameric ion channel , the detailed structure of Pkd2l2 remains to be fully elucidated. Based on the available information about PKD2, researchers can develop hypotheses about Pkd2l2's structure and function.

PKD2's structure reveals several key features: a voltage-sensor domain with two retained gating charges, a constricted ion permeation pathway at the selectivity filter and near the cytoplasmic end of S6 (suggesting two regulatory gates), and an extracellular domain that contributes to channel assembly and interacts with the transmembrane core . These structural elements provide insights into potential activation mechanisms and functional regulation.

For Pkd2l2 structural studies, researchers should consider:

  • Generating truncation constructs similar to those used for PKD2 (which retained functional domains while enhancing biochemical stability)

  • Examining membrane incorporation in nanodiscs or amphipols

  • Investigating the possibility that, like PKD2, cytoplasmic domains of Pkd2l2 may be unstructured or connected to the channel core via flexible linkers

The absence of visible cytoplasmic domains in PKD2 cryo-EM structures, despite their presence in the constructs , suggests that similar challenges may be encountered with Pkd2l2. Researchers should prepare for the possibility that important regulatory domains may not be visible in structural studies, necessitating complementary biochemical approaches to understand their role.

What are the most effective expression systems for producing functional recombinant Pkd2l2 protein?

Choosing the appropriate expression system for Pkd2l2 production requires balancing protein yield, proper folding, and post-translational modifications. Based on successful approaches with related polycystin proteins, several expression systems merit consideration:

For high-yield production of protein for structural studies, insect cell expression systems (Sf9, High Five) offer advantages for membrane proteins like Pkd2l2. These systems provide eukaryotic folding machinery and post-translational modifications while delivering higher yields than mammalian systems. For functional studies requiring proper mammalian glycosylation patterns, HEK293 or CHO cell lines may be preferable despite lower yields.

The approach used for PKD2 structural studies provides a useful template - they identified three PKD2 truncation constructs with enhanced biochemical stability and structural homogeneity . Similarly, for Pkd2l2, researchers should consider creating a panel of constructs with strategic truncations to optimize expression while retaining key functional domains.

A systematic protocol for Pkd2l2 expression might include:

  • Codon optimization of the Pkd2l2 sequence for the chosen expression system

  • Addition of purification tags (His, FLAG, etc.) with precision protease cleavage sites

  • Creation of multiple constructs with various N- and C-terminal boundaries

  • Small-scale expression testing before scaling up production

  • Detergent screening for optimal membrane protein solubilization

  • Affinity purification followed by size exclusion chromatography

For functional validation, researchers should verify that the expressed protein retains channel activity through electrophysiological studies, comparing the activity of full-length and truncated constructs to identify minimal functional units.

What CRISPR/Cas9 strategies can be employed to study Pkd2l2 function in mouse models?

CRISPR/Cas9 genome editing offers powerful approaches for investigating Pkd2l2 function in vivo. Drawing from successful strategies used in PKD research, several approaches can be implemented:

Point mutation knock-in strategies are particularly valuable for structure-function analysis. Based on the importance of the L517 cholesterol-binding site identified in PC2 , researchers could generate analogous mutations in conserved regions of Pkd2l2 to assess their effects on protein localization and function in vivo.

A comprehensive CRISPR/Cas9 strategy might include:

  • Design of multiple guide RNAs targeting conserved functional domains

  • Creation of HDR templates for precise knock-in of mutations or epitope tags

  • Validation of editing efficiency in mouse embryonic stem cells

  • Generation of chimeric mice and breeding to establish germline transmission

  • Phenotypic analysis focusing on kidney morphology, cilia structure, and ion channel function

When designing guide RNAs, researchers should prioritize those with high on-target and low off-target scores, and validate editing outcomes through sequencing to ensure precise modifications have been achieved.

How can researchers effectively analyze the interaction between Pkd2l2 and cholesterol in cellular membranes?

Analyzing Pkd2l2-cholesterol interactions requires specialized techniques that can detect and quantify these associations in membrane environments. Building on methods used to study PC2-cholesterol interactions , several complementary approaches can be employed:

  • Cholesterol pull-down assays: Using biotinylated cholesterol analogs to capture Pkd2l2 from cellular lysates, followed by Western blot detection to quantify binding affinity.

  • Fluorescence-based techniques: FRET (Förster Resonance Energy Transfer) between fluorescently labeled Pkd2l2 and cholesterol analogs can provide dynamic information about these interactions in living cells.

  • Cholesterol depletion/supplementation experiments: Manipulating cellular cholesterol levels using methyl-β-cyclodextrin (MβCD) for depletion and cholesterol-MβCD complexes for supplementation, followed by assessment of Pkd2l2 localization and function.

  • Molecular dynamics simulations: In silico modeling of Pkd2l2-cholesterol interactions can predict binding sites and energetics, guiding experimental designs.

For proper controls, researchers should include:

  • Mutated versions of Pkd2l2 with disrupted cholesterol binding sites

  • Related proteins with known cholesterol binding properties (positive control)

  • Proteins known not to interact with cholesterol (negative control)

Analysis should focus on both static binding properties and dynamic aspects such as how cholesterol binding affects protein conformation and channel function. A specific experiment might involve expressing wild-type Pkd2l2 and putative cholesterol-binding mutants in ciliated cells, depleting cholesterol, and then monitoring protein localization through high-resolution microscopy while simultaneously assessing channel function through electrophysiology or calcium imaging.

How do mutations in Pkd2l2 contribute to polycystic kidney disease pathogenesis compared to mutations in Pkd1 and Pkd2?

The contribution of Pkd2l2 mutations to polycystic kidney disease (PKD) pathogenesis is less well documented compared to the established roles of Pkd1 and Pkd2 mutations. Nevertheless, understanding the potential pathogenic mechanisms is crucial for comprehensive PKD research.

Pkd1 and Pkd2 encode polycystin-1 (PC1) and polycystin-2 (PC2) proteins that physically interact and are co-expressed at multiple subcellular locations, functioning in the same physiological pathway . Mutations in either gene can lead to autosomal dominant polycystic kidney disease (ADPKD), one of the most common human monogenic disorders .

Research has demonstrated that Pkd2 influences the cystic phenotype of Pkd1-mutant models, suggesting a complex interrelationship . For Pkd2l2, researchers should investigate whether it participates in similar interaction networks or represents an independent pathway contributing to cyst formation.

To systematically compare the pathogenic mechanisms:

  • Generate parallel mouse models with mutations in Pkd1, Pkd2, and Pkd2l2

  • Analyze phenotypic differences in kidney morphology, cyst formation, and renal function

  • Perform transcriptomic and proteomic analyses to identify shared and distinct molecular pathways

  • Conduct genetic interaction studies through breeding of different mutant lines

The extracellular domain of PKD2 has been identified as a hotspot for ADPKD pathogenic mutations and contributes to channel assembly . Researchers should determine whether analogous domains in Pkd2l2 harbor similar mutation-sensitive regions and whether these mutations affect protein assembly, localization, or function in ways that promote cyst formation.

What role does Pkd2l2 play in ciliary function and how does its dysregulation impact ciliopathies beyond PKD?

Primary cilia function as cellular antennae that sense and transduce various extracellular signals, and ciliary dysfunction underlies numerous human disorders collectively termed ciliopathies. Polycystin proteins, including PC2, localize to primary cilia where they participate in mechanosensation and signaling . Understanding Pkd2l2's role in ciliary function can provide insights into its potential involvement in ciliopathies beyond PKD.

Research on PC2 has established that proper ciliary localization depends on cholesterol interaction, with disruption leading to cyst formation . For Pkd2l2, researchers should investigate:

  • Its precise subcellular localization pattern in ciliated cells

  • The molecular mechanisms governing its trafficking to cilia

  • Its interaction partners within the ciliary membrane

  • Signaling pathways activated by Pkd2l2 in response to ciliary stimuli

Beyond kidney cysts, ciliary dysfunction can manifest as diverse phenotypes including retinal degeneration, brain malformations, skeletal abnormalities, and laterality defects. The finding that PC2 L517R mutation is associated with heterotaxy suggests that Pkd2l2 dysfunction might similarly impact multiple organ systems.

A comprehensive approach to studying Pkd2l2 in ciliopathies would include:

  • Analysis of Pkd2l2 expression patterns across tissues known to be affected in ciliopathies

  • Phenotypic characterization of Pkd2l2-mutant models beyond renal effects

  • Investigation of Pkd2l2 interactions with established ciliopathy proteins

  • Patient-based studies examining Pkd2l2 variants in ciliopathy cohorts without identified genetic causes

How might the understanding of Pkd2l2-cholesterol interactions inform novel therapeutic approaches for polycystic kidney disease?

The discovery that cholesterol plays a critical role in PC2 ciliary localization and that disruption of this interaction contributes to cyst formation opens new therapeutic avenues for PKD. If Pkd2l2-cholesterol interactions operate through similar mechanisms, they could represent additional therapeutic targets.

Several potential therapeutic strategies emerge from this understanding:

  • Cholesterol modulation therapies: Targeted delivery of cholesterol to kidney tissue might rescue localization defects of certain polycystin mutants. Conversely, in scenarios where mislocalized channels contribute to pathology, cholesterol depletion might provide benefits.

  • Small molecule stabilizers: Development of compounds that stabilize the interaction between Pkd2l2 and cholesterol, potentially compensating for mutations that weaken this interaction.

  • Gene therapy approaches: CRISPR-based strategies to correct pathogenic mutations in cholesterol-binding domains or to enhance expression of wild-type Pkd2l2 in cases of haploinsufficiency.

  • Combination therapies: Targeting multiple polycystin family members simultaneously, given the evidence that Pkd2 influences Pkd1-mutant phenotypes .

For any therapeutic development program, researchers should establish:

  • Preclinical models that accurately recapitulate the relevant disease mechanisms

  • Biomarkers to assess therapeutic efficacy

  • Delivery methods that can achieve sufficient target engagement in kidney tissue

  • Safety profiles, particularly for approaches that broadly modulate cholesterol levels

The recent observation that eliminating a single 3′-UTR miR-17 motif in Pkd1 or Pkd2 can alleviate cyst growth highlights the potential for precisely targeted interventions. Similar regulatory elements might exist for Pkd2l2, offering additional targets for RNA-based therapeutics.

How does Pkd2l2 interact with other polycystin family members in signaling complexes?

Understanding the interaction network of Pkd2l2 with other polycystin family members is crucial for elucidating its role in cellular signaling. Research on PC1 and PC2 has established that these proteins physically interact and function in the same physiological pathway . Whether Pkd2l2 participates in similar complexes or forms distinct signaling assemblies remains an important research question.

Several approaches can be employed to map Pkd2l2 interactions:

  • Co-immunoprecipitation studies: Using tagged versions of Pkd2l2 to pull down interaction partners, followed by mass spectrometry identification.

  • Proximity labeling techniques: Methods such as BioID or APEX2 can identify proteins in close proximity to Pkd2l2 in living cells, potentially capturing transient interactions.

  • FRET-based interaction assays: To visualize interactions in real-time within living cells and determine subcellular locations where these interactions occur.

  • Yeast two-hybrid or mammalian two-hybrid screens: To systematically test for direct interactions with other polycystin family members.

Evidence from PKD research suggests that enhancing Pkd2 expression in Pkd1-mutant cells may improve PC1 trafficking and/or form more heteromeric PC1-PC2 protein complexes . This raises the possibility that Pkd2l2 might similarly influence the trafficking or function of other polycystins. Researchers should investigate whether:

  • Pkd2l2 forms heteromeric channels with other TRP family members

  • Pkd2l2 influences the localization or stability of other polycystins

  • Signaling outputs differ between homomeric Pkd2l2 channels and heteromeric complexes

  • Disease-associated mutations affect these interaction patterns

What are the structural determinants of Pkd2l2 ion selectivity and how do they compare to other polycystin channels?

Ion selectivity is a fundamental property of ion channels that determines their physiological function. For Pkd2l2, understanding the structural basis of ion selectivity requires detailed analysis of the channel pore architecture. Drawing from the cryo-EM structure of PKD2, which reveals a constricted ion permeation pathway at the selectivity filter , researchers can formulate hypotheses about Pkd2l2 selectivity.

Key structural elements likely to determine Pkd2l2 ion selectivity include:

  • Pore-lining residues: Particularly those in the selectivity filter region that coordinate permeating ions.

  • Channel diameter: The minimal diameter of the pore constrains which ions can pass through.

  • Electrostatic environment: The distribution of charged residues along the permeation pathway influences ion preference.

  • Hydration shell interactions: How the channel interacts with the hydration shells of different ions affects selectivity.

To experimentally determine Pkd2l2 selectivity, researchers should conduct:

  • Ion substitution experiments in electrophysiological recordings

  • Reversal potential measurements under bi-ionic conditions

  • Single-channel conductance measurements with different permeant ions

  • Mutagenesis of putative selectivity filter residues to assess their contribution

A systematic comparison of selectivity determinants across polycystin channels might reveal:

ChannelPredicted Selectivity Filter ResiduesIon PreferenceDistinguishing Features
PKD2Identified in cryo-EM structure Cation selectiveTwo regulatory gates
Pkd2l1(Based on published data)Ca²⁺-permeableHigher Ca²⁺ permeability than PKD2
Pkd2l2(To be determined)(To be determined)(To be determined)

Understanding these differences could provide insights into the evolutionary diversification of polycystin channels and their specialized functions across tissues.

How does Pkd2l2 expression and function change during kidney development and in response to injury?

The temporal and spatial regulation of Pkd2l2 expression during kidney development and in response to injury represents an important aspect of its physiological and pathological roles. Understanding these dynamics can provide insights into when and where therapeutic interventions might be most effective.

During kidney development, polycystin proteins play crucial roles in tubulogenesis and nephron maturation. To characterize Pkd2l2's developmental expression:

  • Perform RNA-seq and protein expression analysis across developmental timepoints

  • Use in situ hybridization and immunohistochemistry to map spatial expression patterns

  • Generate reporter mice with fluorescent proteins driven by the Pkd2l2 promoter

  • Compare Pkd2l2 expression patterns with those of Pkd1 and Pkd2

In the context of kidney injury, polycystin expression changes may contribute to repair processes or, conversely, to maladaptive responses leading to cyst formation. To study Pkd2l2 in injury settings:

  • Use established models of acute kidney injury (ischemia-reperfusion, nephrotoxins)

  • Analyze time-course of Pkd2l2 expression changes after injury

  • Determine whether Pkd2l2 genetic variants modify injury responses

  • Test whether pharmacological modulation of Pkd2l2 function affects recovery

The potential interaction between developmental programs and injury responses is particularly relevant in PKD, where developmental pathways are often reactivated following injury. Researchers should investigate whether:

  • Developmental expression patterns of Pkd2l2 are recapitulated after injury

  • Early developmental or injury-induced changes in Pkd2l2 expression predict later cyst formation

  • The cellular and molecular context (e.g., cholesterol content of membranes) modifies Pkd2l2 function differently during development versus injury

Understanding these dynamics could identify critical windows for therapeutic intervention in PKD and other kidney diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.