Recombinant Mouse Polypeptide N-acetylgalactosaminyltransferase 1 (Galnt1)
Shipped with Ice Packs 
In Stock 
Description
-
Specific Activity: >300 pmol/min/μg (human ortholog; mouse activity inferred similarly) .
-
Assay Protocol:
Biological Function and Research Applications
Galnt1 initiates O-glycosylation, a modification linked to cellular adhesion, signaling, and cancer progression.
Role in O-Glycosylation
-
Substrate Specificity: Targets peptides such as MUC1, MUC5AC, and MUC7 .
-
Hierarchy: Acts as an "early transferase" for nonglycosylated or monoglycosylated substrates .
Cancer Research
A study in hepatocellular carcinoma (HCC) revealed:
| Observation | Mechanism | Outcome |
|---|---|---|
| GALNT1 Overexpression | Enhanced EGFR activation via reduced O-glycosylation | Increased cell migration/invasion |
| GALNT1 Knockdown | Delayed EGFR degradation; increased co-localization with lysosomes (LAMP1) | Suppressed migration/invasion |
| EGFR Signaling | Downregulation of p-Y1068 (activated EGFR) and accelerated degradation | Reduced tumor aggressiveness |
Key Findings:
-
GALNT1 knockdown in HCC cells (e.g., HA22T, PLC5) reduced EGF-induced migration by >50% .
-
EGFR degradation rate increased 2–3-fold in GALNT1-deficient cells .
Applications in Research
Comparative Analysis of Recombinant Proteins
Product Specs
Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
Galnt1; Polypeptide N-acetylgalactosaminyltransferase 1; Polypeptide GalNAc transferase 1; GalNAc-T1; pp-GaNTase 1; Protein-UDP acetylgalactosaminyltransferase 1; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-559
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Galnt1
Target Protein Sequence
MRKFAYCKVVLATSLVWVLLDMFLLLYFSECNKCEEKQERGLPAGDVLELVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRLGLRRKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCTGSRSQQWLLRNVTLPEIF
Uniprot No.
Target Background
Function
Recombinant Mouse Polypeptide N-acetylgalactosaminyltransferase 1 (Galnt1) catalyzes the initial step in O-linked oligosaccharide biosynthesis: the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. It exhibits broad substrate specificity, acting on various peptides including EA2, Muc5AC, Muc1a, Muc1b, and Muc7.
Gene References Into Functions
- ppGalNAc-T4 showed high expression in MC3T3-E1 cells during osteogenesis. ppGalNAc-T1 and -T4 differentially affected osteogenic factor expression, indicating distinct roles in regulating in vitro osteogenesis. PMID: 27965094
- Galnt1 null mice exhibited compromised cardiac function, mimicking human congenital heart disease, suggesting Galnt1's essential role in normal heart valve development. PMID: 25615642
- GALNT1 represents the glycosyltransferase enzyme family encompassing a single known glycosidic linkage. PMID: 22183981
- Polypeptide GalNAcT-1 plays a crucial role in in vivo leukocyte recruitment by attaching functionally relevant O-linked glycans to L-selectin ligands. PMID: 22544932
- Each ppGalNAc-T isoform demonstrates unique sensitivity to peptide sequence and overall charge, influencing glycosylation substrate sites. PMID: 21349845
- Growth factor stimulation regulates O-glycosylation initiation in a Src-dependent manner through GalNAc-T redistribution from the Golgi to the endoplasmic reticulum. PMID: 20498016
- ppGalNAcT-1 is indispensable for O-glycosylation at specific sites on the bone glycoproteins OPN and BSP. PMID: 19880513
- Protein O-glycosylation initiation by ppGalNAcT-1 supports vascular responses and humoral immunity. PMID: 17923703
Database Links
Protein Families
Glycosyltransferase 2 family, GalNAc-T subfamily
Subcellular Location
[Polypeptide N-acetylgalactosaminyltransferase 1]: Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein.; [Polypeptide N-acetylgalactosaminyltransferase 1 soluble form]: Secreted.
Tissue Specificity
Widely expressed at high level. Higher expression in kidney, heart, small intestine and cervix and to a lesser extent in all the other tissues tested.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
