Recombinant Mouse Popeye domain-containing protein 2 (Popdc2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Popdc2; Pop2; Popeye domain-containing protein 2; Popeye protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-367
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Popdc2
Target Protein Sequence
MSANGSSVAQLLWQPPVCRSWKPDVEGAVYHLANCFLLMGFMAGSGVYGCFYLFGILGPG YLCCVLWGWFDACGLDIVLWNVLLTVACLLQLAQLVYRVRVNTLPEEFNLLYRTLCLPLQ VPLQVYKEIVHCCHEQVLTLATEQTYAVEGETPINRLSLLLSGRVRVSQDGQFLHYIFPY QFMDSPEWESLHPSEEGTFQVTLTAETECSYISWPRKNLYLLLNRERYISRLFSALLGYD ISEKLYTLNDKLFAKFGLRFDIRLPSLYHVLSPSASDGEPESEKDDEEALEAAVSPAQAR PICIVPTPPCSAPPATTNFPVPLPRARMPRMPRPDSGNLASRRPLQNSSQVMSRSQAPLA PIHTPEL
Uniprot No.

Target Background

Function
POPDC2 is crucial for maintaining cardiac function. It plays a regulatory role in heart rate dynamics, at least partly through cAMP binding and possibly by increasing cell surface expression of the potassium channel KCNK2, thus enhancing current density.
Gene References Into Functions
  1. Sequential MEIS1 and NKX2-5 binding to the Popdc2 gene demonstrates a mechanism for spatiotemporal enhancer regulation during cardiogenesis. PMID: 26411676
  2. Popdc2 is expressed in various muscle and non-muscle cell types during embryonic development and postnatal life. PMID: 18189275
Database Links
Protein Families
Popeye family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell membrane, sarcolemma.
Tissue Specificity
Expressed in the developing and adult heart, with high expression levels in the sinus and atrioventricular nodes. Also expressed in the bladder and skeletal muscle.

Q&A

What is the basic structure of mouse Popdc2?

Popdc2 is a member of the POP family of proteins containing three putative transmembrane domains. It is a membrane-associated protein with the Popeye domain located in the cytoplasmic portion. This domain displays limited sequence homology to other proteins, while sequence conservation amongst Popeye proteins is high, amounting to approximately 40%–60% . The protein structure includes a cAMP binding region that shares structural similarity with other cAMP-binding domains found in eukaryotic protein kinase A (PKA) and HCN channels .

What is the primary function of Popdc2 in cellular systems?

Popdc2 functions as a cAMP effector protein in cellular systems . It binds cyclic nucleotides with a binding affinity (IC50) for cAMP of 120 nM, which is comparable to the affinities reported for PKA (100 nM) and HCN4 (240 nM) . This interaction regulates various downstream cellular processes, particularly in striated muscle tissue. One of the key interacting proteins is the two-pore potassium (K2P) channel TREK-1, where Popdc2 enhances TREK-1 current by increasing its membrane representation, suggesting a role in modulating ion channel trafficking .

What is the tissue expression pattern of Popdc2?

Popdc2 is predominantly expressed in skeletal and cardiac muscle tissues . In zebrafish embryonic development, Popdc2 transcripts are detected in the embryonic myocardium and transiently in the craniofacial and tail musculature . This expression pattern aligns with its functional role in these tissues and explains why defects in Popdc2 primarily affect cardiac and skeletal muscle development and function.

How evolutionarily conserved is Popdc2 across species?

Popdc2 shows remarkable evolutionary conservation across vertebrate species. The gene has been identified in humans, mice, rats, horses, domestic cats, dogs, chickens, zebrafish, naked mole-rats, domestic guinea pigs, sheep, and cows . The high degree of conservation suggests the fundamental importance of this protein in vertebrate physiology, particularly in muscle tissue development and function.

What are the standard methods for studying Popdc2 gene expression?

Standard methods for studying Popdc2 gene expression include RT-PCR analysis using gene-specific primers. For zebrafish studies, primers such as zf-popdc2-fw (5′-GACGGGGAACAGAAGCACAGACA-3′) and zf-popdc2-rev (5′-ACCGCCCATATAGCCCAGAAAAA-3′) have been used effectively . In situ hybridization can also be employed to analyze spatial expression patterns during development. For protein-level analysis, immunohistochemistry with specific antibodies against Popdc2 is commonly used to visualize its cellular and subcellular localization in tissue sections.

What approaches are recommended for Popdc2 knockdown studies?

For Popdc2 knockdown studies in zebrafish, morpholino oligonucleotides targeted to splice donor and acceptor sequences have proven effective. Specifically, morpholinos targeting the splice donor (MO2) and acceptor sequences (MO1) of intron 1 have been used successfully to suppress expression of the popdc2 transcript . These can be used singly or in combination. Validation of knockdown efficiency should include RT-PCR analysis to detect aberrantly spliced transcripts. For rescue experiments, mouse Popdc2 cRNA (approximately 100 pg) can be co-injected with morpholinos (1 ng of MO1-popdc2) to confirm phenotype specificity .

How can researchers effectively produce recombinant Popdc2 protein for in vitro studies?

Recombinant mouse Popdc2 protein can be produced using bacterial or mammalian expression systems. For bacterial expression, the protein sequence from Ser2-Lys255 with an N-terminal His tag has been successfully used . The recombinant protein can be purified using affinity chromatography with nickel columns for His-tagged proteins. For functional studies, it's important to ensure proper folding of the protein, particularly the Popeye domain, which is crucial for cAMP binding. Mammalian expression systems may provide better post-translational modifications and protein folding compared to bacterial systems.

What are appropriate control experiments when studying Popdc2 function?

Appropriate controls for Popdc2 functional studies include:

  • Using control morpholinos with similar chemical properties but no target in the organism for knockdown studies

  • Rescue experiments using wild-type Popdc2 cRNA to confirm phenotype specificity

  • Including both positive controls (tissues known to express Popdc2) and negative controls (tissues not expressing Popdc2) for expression studies

  • When studying cAMP binding, comparing with other known cAMP-binding proteins like PKA as reference standards

  • For interaction studies, including both positive interacting proteins (e.g., TREK-1) and non-interacting proteins as controls

How does Popdc2 interact with the cAMP signaling pathway?

Popdc2 functions as a novel class of cAMP effector protein . The Popeye domain binds cyclic nucleotides with an affinity comparable to other well-established cAMP-binding proteins. The closest related non-Popdc proteins are bacterial CAP or CRP proteins, which function as cyclic nucleotide-regulated transcription factors . Popdc2 interacts with other components of the cAMP signaling pathway, including phosphodiesterase 4 (PDE4) and adenylyl cyclase 9 (AC9) . These interactions suggest that Popdc2 may serve as a crucial mediator between cAMP signaling and downstream cellular processes, particularly in muscle tissues.

What phenotypes are observed in Popdc2 knockout/knockdown models?

In Popdc2 knockout mice, a stress-induced sinus node bradycardia is observed, which is strictly stress-dependent. At rest, a normal ECG is observed . In zebrafish popdc2 morphants, more severe phenotypes are observed:

  • Aberrant development of skeletal muscle, with irregularly shaped muscle segments in the trunk

  • Severely reduced or missing craniofacial muscles

  • Pericardial edema and elongated heart chambers with abnormal looping

  • Cardiac arrhythmia, with irregular ventricular contractions showing a 2:1 or 3:1 atrial/ventricular conduction ratio

These phenotypes highlight Popdc2's crucial role in both cardiac and skeletal muscle development and function.

What is the relationship between Popdc2 and ion channel function?

Popdc2 has been demonstrated to interact with the two-pore potassium (K2P) channel TREK-1. In the presence of Popdc proteins, TREK-1 current is increased due to enhanced membrane representation of the channel, suggesting a role for Popdc2 in modulating ion channel trafficking . The cardiac arrhythmia observed in popdc2 morphants resembles the phenotype of the breakdance mutant in zebrafish, which is defective in the Kcnh2 potassium channel involved in cardiac repolarization . This suggests that Popdc2 may play a role in cardiac repolarization, possibly through interactions with potassium channels.

How do Popdc2 mutations affect heteromeric interactions with other proteins?

Mutations in Popdc2 can affect its interactions with partner proteins, including other members of the Popdc family and ion channels. The ability of Popdc2 to form heteromeric complexes is critical for its function in muscle and cardiac tissues. Mutations may disrupt protein-protein interactions, cAMP binding capacity, or subcellular localization, leading to dysfunction in cardiac conduction and muscle development . Specific experimental approaches to study these heteromeric interactions include co-immunoprecipitation, yeast two-hybrid assays, and fluorescence resonance energy transfer (FRET) techniques.

What methodological challenges exist in studying Popdc2's role in cardiac conduction?

Studying Popdc2's role in cardiac conduction presents several methodological challenges:

  • The stress-dependent nature of arrhythmias in Popdc2-deficient models requires specialized protocols to induce and record cardiac stress responses

  • Distinguishing between primary conduction defects and secondary effects from structural abnormalities requires sophisticated electrophysiological techniques

  • The relationship between Popdc2 and other cardiac ion channels necessitates complex interaction studies

  • In vivo cardiac imaging in small animal models requires high spatiotemporal resolution techniques

Researchers have addressed these challenges using optical recordings of cardiac contractility and calcium transients with high spatiotemporal resolution, such as employing transgenic calcium indicator lines (e.g., Tg(cmlc2:gCaMP)s878) and SPIM microscopy .

How can researchers effectively analyze the dual role of Popdc2 in cardiac and skeletal muscle development?

To effectively analyze Popdc2's dual role in cardiac and skeletal muscle development, researchers should employ a multi-faceted approach:

  • Tissue-specific conditional knockout models to separate cardiac and skeletal muscle functions

  • Time-course analysis of gene expression during embryonic development to identify critical windows for each tissue

  • Combining morphological assessment with functional studies:

    • For cardiac function: ECG recordings, optical mapping, calcium imaging

    • For skeletal muscle: phalloidin staining, analysis of myofibrillar organization, assessment of muscle force generation

  • Expression of tissue-specific rescue constructs to delineate tissue-autonomous versus non-autonomous effects

  • Analysis of different muscle types (e.g., fast vs. slow muscle fibers) to determine fiber-type specificity

This comprehensive approach can help distinguish between the cardiac and skeletal muscle functions of Popdc2.

What are the known human pathogenic variants in POPDC2 and their functional consequences?

A number of patients carrying pathogenic variants in POPDC genes, including POPDC2, have been identified and suffer from heart and/or muscle disease . While the search results don't provide specific details about POPDC2 variants, the conservation of function between mouse and human suggests that mutations would likely affect cardiac rhythm, particularly under stress conditions, and potentially skeletal muscle development and function. Research approaches to study these variants include:

  • Generation of patient-specific induced pluripotent stem cells (iPSCs) and differentiation into cardiomyocytes

  • CRISPR-Cas9 gene editing to introduce specific variants into model systems

  • Electrophysiological characterization of variant effects on cardiac conduction

  • Protein interaction studies to assess the impact on binding partners like ion channels

How do the functions of Popdc2 compare with other Popdc family members?

The Popdc family includes Popdc1 (also known as Bves), Popdc2, and Popdc3. These proteins share structural similarities but may have distinct and overlapping functions:

  • Both Popdc1 and Popdc2 knockout mice display nearly identical stress-induced sinus node bradycardia, suggesting functional overlap in cardiac conduction

  • Popdc1 knockout mice show enhanced vulnerability to ischemia-reperfusion and impaired skeletal muscle regeneration after injury

  • In zebrafish, both bves (Popdc1) knockout mutants and popdc2 morphants display cardiac arrhythmia and muscular dystrophy, indicating conserved functions

  • All Popdc family members are expressed in muscle and heart across vertebrates, suggesting conserved tissue-specific roles

Comprehensive comparative studies of all three family members are needed to fully understand their unique and redundant functions.

What future research directions hold the most promise for translating Popdc2 research to clinical applications?

Promising future research directions for translating Popdc2 research to clinical applications include:

  • Comprehensive cataloging of human POPDC2 variants in patients with cardiac arrhythmias and muscle disorders

  • Development of small molecules that can modulate Popdc2-cAMP interactions for potential therapeutic applications

  • Investigation of the role of Popdc2 in cardiac ischemia-reperfusion injury and potential protective strategies

  • Exploration of Popdc2's involvement in age-related cardiac conduction disorders

  • Study of interactions between Popdc2 and pharmacological agents used to treat arrhythmias

  • Development of tissue-specific gene therapy approaches to correct POPDC2 deficiencies

These directions could lead to novel diagnostic markers and therapeutic targets for cardiac arrhythmias and muscle disorders.

What are the optimal conditions for preserving Popdc2 protein activity in recombinant preparations?

Optimal conditions for preserving Popdc2 protein activity in recombinant preparations include:

  • Maintaining appropriate pH (typically 7.2-7.4) and ionic strength similar to physiological conditions

  • Including stabilizing agents such as glycerol (10-20%) to prevent protein denaturation

  • Adding reducing agents (DTT or β-mercaptoethanol) to maintain cysteine residues in reduced form

  • Storing at -80°C for long-term storage, with minimal freeze-thaw cycles

  • Including protease inhibitors to prevent degradation

  • For functional studies involving cAMP binding, ensuring the buffer conditions support nucleotide binding

These conditions should be optimized based on the specific experimental application and the protein construct being used.

How can researchers differentiate between direct and indirect effects of Popdc2 on ion channel function?

To differentiate between direct and indirect effects of Popdc2 on ion channel function, researchers can employ:

  • Direct binding assays: Co-immunoprecipitation, FRET, and surface plasmon resonance to demonstrate physical interaction between Popdc2 and ion channels

  • Reconstitution experiments: Expressing Popdc2 and ion channels in heterologous expression systems that lack endogenous Popdc proteins

  • Domain mapping studies: Creating chimeric or truncated Popdc2 proteins to identify specific domains required for ion channel interactions

  • Acute manipulation experiments: Using rapid inhibition or activation of Popdc2 to distinguish immediate (likely direct) effects from delayed (possibly indirect) effects

  • Pathway inhibition studies: Systematically blocking potential intermediate signaling molecules to identify indirect pathways

These approaches collectively can help establish the mechanistic basis of Popdc2's effects on ion channel function.

What are the recommended methods for studying cAMP binding to Popdc2?

Recommended methods for studying cAMP binding to Popdc2 include:

  • Radioligand binding assays: Using [³H]-cAMP or [³²P]-cAMP to measure direct binding to purified Popdc2 protein

  • Fluorescence-based assays: Employing fluorescently labeled cAMP analogs and measuring changes in fluorescence upon binding

  • Surface plasmon resonance (SPR): Immobilizing Popdc2 on a sensor chip and measuring binding kinetics of cAMP in real-time

  • Isothermal titration calorimetry (ITC): Providing thermodynamic parameters of binding without requiring labels

  • FRET-based sensors: Creating chimeric proteins combining Popdc2 with fluorescent proteins to detect conformational changes upon cAMP binding

When designing these experiments, it's important to compare results with established cAMP-binding proteins such as PKA (IC50 ~100 nM) and HCN4 (IC50 ~240 nM) as reference standards .

What are the emerging roles of Popdc2 beyond cardiac and skeletal muscle?

While Popdc2 is predominantly studied in cardiac and skeletal muscle contexts, emerging evidence suggests broader roles that warrant investigation:

  • Potential involvement in smooth muscle function, particularly in vascular tissues

  • Possible roles in non-muscle tissues where cAMP signaling is important

  • Interactions with additional ion channels beyond TREK-1

  • Potential involvement in cellular responses to stress and hypoxia

  • Roles in development and regeneration outside the muscle context

These emerging areas represent important directions for future research to fully understand the biological significance of Popdc2.

How might understanding Popdc2 function contribute to developing therapies for cardiac arrhythmias?

Understanding Popdc2 function could contribute to developing therapies for cardiac arrhythmias through:

  • Identification of novel drug targets within the Popdc2-associated signaling network

  • Development of small molecules that modulate Popdc2-cAMP binding or Popdc2-ion channel interactions

  • Gene therapy approaches to correct deficient or mutant POPDC2 in patients with arrhythmias

  • Biomarkers for identifying patients at risk for stress-induced arrhythmias

  • Personalized medicine approaches based on patient-specific POPDC2 genetic variants

  • Improved understanding of the molecular basis of stress-dependent arrhythmias, which remain challenging to treat

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.