Recombinant Mouse Potassium channel subfamily K member 18 (Kcnk18)

Shipped with Ice Packs
In Stock

Description

Production and Functional Analysis

Recombinant Kcnk18 is synthesized using advanced heterologous expression systems:

  • HEK293 cells: Provide post-translational modifications (e.g., glycosylation) mimicking native channels .

  • Tandem dimer constructs: Enable controlled stoichiometry for studying dominant-negative mutations (e.g., A34V) .

Functional studies reveal:

  • Calcineurin activation: Intracellular Ca²⁺ elevation induces dephosphorylation, increasing channel activity .

  • Kinase inhibition: PAR-1/MARK phosphorylation reduces current amplitude .

  • Migraine-linked mutations: Frameshift (F139Wfsx24) and missense (C110R) variants cause complete loss of function or reduced activity .

Migraine Pathophysiology

  • Loss-of-function variants (e.g., C110R) disrupt K⁺ leakage currents, increasing trigeminal ganglion neuron excitability .

  • Dominant-negative effects: Mutant subunits (e.g., A34V) suppress wild-type channel activity in heterodimers .

Pain Signaling

  • Dorsal root ganglia (DRG) expression: Modulates nociceptor excitability in inflammatory and neuropathic pain models .

  • TRESK knockout mice: Exhibit heightened mechanical hypersensitivity .

Pharmacological Studies

  • Drug screening: Used to identify compounds targeting TRESK for migraine therapy .

  • Ionomycin assays: Validate calcineurin-dependent activation in heterologous systems .

Table 2: Cross-Species Homology of Kcnk18

SpeciesUniProt IDIdentity vs. MouseKey Functional Domains Conserved
Human (KCNK18)Q7Z41889%Pore domains, phosphorylation sites
RatQ6VV6495%Intracellular regulatory loop
ZebrafishN/A75%Transmembrane topology

Challenges and Future Directions

  • Structural limitations: No crystal structure available; homology models rely on KvAP templates .

  • Copy number variation (CNV): No association found between Kcnk18 CNV and migraine in human cohorts .

  • Therapeutic potential: TRESK activators could normalize neuronal hyperexcitability in migraineurs .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly sent with blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing it.
Synonyms
Kcnk18; Tresk-2; Tresk2; Potassium channel subfamily K member 18; Two-pore-domain potassium channel TRESK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-394
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Kcnk18
Target Protein Sequence
MEAEEPPEARRCCPEALGKARGCCPEALGKLLPGLCFLCCLVTYALVGAALFSAVEGRPD PEAEENPELKKFLDDLCNILKCNLTVVEGSRKNLCEHLQHLKPQWLKAPQDWSFLSALFF CCTVFSTVGYGHMYPVTRLGKFLCMLYALFGIPLMFLVLTDIGDILATILSRAYSRFQAL LCLPHDIFKWRSLPLCRKQPDSKPVEEAIPQIVIDAGVDELLNPQPSKDPPSPSCNVELF ERLVAREKKNKLQPPTRPVERSNSCPELVLGRLSCSILSNLDEVGQQVERLDIPLPVIAL VVFAYISCAAAILPFWETELGFEDAFYFCFVTLTTIGFGDIVLVHPHFFLFFSIYIIVGM EILFIAFKLMQNRLLHTYKTLMLFVCQREVSLPW
Uniprot No.

Target Background

Function
TRESK (TWIK-related spinal cord K+ channel) is an outward rectifying potassium channel responsible for generating rapidly activating outward rectifier K(+) currents. It may function as a background potassium channel that sets the resting membrane potential. Channel activity is directly activated by calcium signals. It is activated via the G(q)-protein coupled receptor pathway. The calcium signal robustly activates the channel through calcineurin, while 14-3-3/YWHAH anchoring hinders the return of the current to the resting state after activation. TRESK is also inhibited by arachidonic acid and other naturally occurring unsaturated free fatty acids. Additionally, its channel activity is enhanced by volatile anesthetics, such as isoflurane. TRESK appears to be the primary target of hydroxy-alpha-sanshool, an ingredient of Sichuan pepper. It may be involved in somatosensory function, particularly in pain sensation.
Gene References Into Functions
  1. We compared the kinetics of Ba2+ block in phosphorylated (inhibited) and dephosphorylated (activated) channels, as well as in different mutants mimicking these two functional states. Neither phosphorylation/dephosphorylation nor the point mutations affected the development of Ba2+ block, suggesting that conformational changes in the bundle crossing region do not contribute to phosphorylation-dependent gating of TRESK. PMID: 29763475
  2. Migraine-associated TRESK mutation, but not the C110R variant, reduced the endogenous TRESK currents to a degree that affects trigeminal ganglion neuron excitability PMID: 24805079
  3. Identification of the blocker binding site in mouse TRESK through molecular modeling and mutational studies PMID: 23200789
  4. A role for TRESK in the pathogenesis of typical migraine with aura. PMID: 20871611
  5. A single residue of TRESK was found to be glycosylated upon heterologous expression. Signals of the N-glycosylation mutants were reduced by >50% due to inadequate surface expression of the channel. PMID: 20006580
  6. TRESK-2 is a functional member of the K(2P) channel family and contributes to the background K+ conductance in many types of cells [TRESK-2] PMID: 15123670
  7. The PQIVID sequence is a docking site for calcineurin, and its occupancy is required for the calcium-dependent regulation of TRESK PMID: 16569637
  8. We found no difference in resting membrane potential between dorsal root ganglia neurones of TRESK[wild type] and TRESK knockout mice PMID: 17962323
  9. Because 14-3-3 proteins are ubiquitous, they are expected to control the duration of calcineurin-mediated TRESK activation in all cell types that express the channel, depending on the phosphorylation state of serine 264. PMID: 18397886

Show More

Hide All

Database Links
Protein Families
Two pore domain potassium channel (TC 1.A.1.8) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in brain cortex, cerebellum, dorsal root ganglion, spinal cord and testis. High expression in trigeminal ganglion, also expressed in autonomic nervous system ganglia such as the stellate ganglion and paravertebral sympathetic ganglia. Expressed i

Q&A

What is KCNK18 and what is its physiological role?

KCNK18, also known as TRESK (TWIK-related spinal cord potassium channel), is a member of the two-pore domain (K2P) potassium channel family. These channels generate background K+ leakage currents that regulate resting membrane potential . KCNK18 has a unique structure featuring four transmembrane domains and two pore-forming domains per subunit, typically forming homodimers .

Physiologically, KCNK18 is predominantly expressed in the dorsal root ganglia (DRG) and trigeminal ganglion (TG), suggesting a critical role in pain pathways . It is also expressed in autonomic nervous system ganglia (e.g., stellate ganglia and paraspinal sympathetic ganglia) and various brain regions including the hypothalamus, frontal cortex, hippocampus, and substantia nigra .

What is the molecular structure of mouse KCNK18?

Mouse KCNK18 protein has a molecular weight of approximately 98-110 kDa. Each subunit contains:

  • Four transmembrane domains (TMDs)

  • Two pore-forming domains

  • An extracellular domain between TMD1 and TMD2 containing:

    • A conserved cysteine residue forming disulfide bonds for dimerization

    • A conserved N-linked glycosylation site for surface expression

  • A large intracellular regulatory domain between TMD2 and TMD3 with phosphorylation sites

The full mouse KCNK18 sequence as referenced in databases is available, with UniProt ID Q6VV64 for mouse KCNK18 .

How is KCNK18 activity regulated at the molecular level?

KCNK18 activity is primarily regulated through phosphorylation/dephosphorylation mechanisms:

  • The intracellular regulatory domain between TMD2 and TMD3 contains serine residues that can be phosphorylated by various kinases, which downregulates channel activity .

  • In response to increased intracellular Ca²⁺, calcineurin dephosphorylates these residues, activating the channel .

  • Mutations that affect these regulatory processes can significantly alter channel function. For example, the S252L mutation may reduce the phosphorylation state of the channel compared to wild-type TRESK .

This regulatory mechanism is unique among K2P channels and makes KCNK18 particularly responsive to calcium signaling within neurons.

What functional assays are most effective for characterizing recombinant mouse KCNK18 activity?

For rigorous functional characterization of recombinant mouse KCNK18, researchers should consider the following methodological approaches:

  • Xenopus oocyte expression system: This has proven effective for electrophysiological studies of KCNK18. Following mRNA injection, whole-cell patch-clamp recordings can assess both basal and stimulated currents .

  • Calcium-dependent activation assessment: Ionomycin-induced calcium elevation can be used to measure KCNK18 activation via calcineurin-mediated dephosphorylation. The protocol typically involves:

    • Establishing baseline current measurement

    • Applying 500 nM ionomycin

    • Measuring the resulting current amplification (wild-type channels show robust amplification)

  • Phosphorylation state analysis: Utilizing phospho-specific antibodies similar to those used for other potassium channels (e.g., Kv3.1) can help determine the phosphorylation status of key serine residues in the regulatory domain.

  • Dimerization studies: Co-expression of wild-type and mutant KCNK18 in equal proportions can evaluate dominant-negative effects of mutations .

How do disease-associated mutations affect KCNK18 function, and what experimental approaches best detect these functional changes?

Several mutations in KCNK18 have been associated with neurological disorders. Effective experimental approaches for characterizing these mutations include:

  • Electrophysiological comparison: Wild-type and mutant channels can be compared for:

    • Basal current amplitude and rectification properties

    • Responsiveness to calcium signaling via ionomycin stimulation

    • Voltage dependence characteristics

  • Dominant-negative effect assessment: Co-expressing wild-type and mutant channels in various ratios can determine if mutant subunits suppress wild-type channel function, as observed with the F139WfsX24 frameshift mutation associated with migraine .

  • In silico analysis: Programs such as PolyPhen2 and SIFT can provide initial predictions of mutation pathogenicity, which should then be validated experimentally .

Research has identified several key mutations with distinct functional impacts:

  • F139WfsX24: Complete loss of function with dominant-negative effect on wild-type channels

  • Y163D: Impaired response to calcineurin activation without affecting basal activity

  • S252L: Slightly increased basal current without statistical significance

What are the technical challenges in producing functional recombinant mouse KCNK18 protein, and how can they be overcome?

Producing functional recombinant mouse KCNK18 presents several challenges:

  • Transmembrane protein expression: As a membrane protein with four transmembrane domains, KCNK18 can be difficult to express and purify in functional form. Solutions include:

    • Using mammalian expression systems like HEK293 cells that provide appropriate post-translational modifications and membrane insertion machinery

    • Employing detergent screening to identify optimal solubilization conditions that maintain channel structure

  • Protein folding and dimerization: Ensuring proper folding and dimerization is critical for function. Approaches include:

    • Adding stabilizing agents during purification

    • Including the conserved extracellular cysteine residue critical for disulfide bond formation and dimerization

    • Verifying glycosylation status of the N-linked site in the extracellular domain

  • Functional verification: Confirming that recombinant protein retains native function can be achieved through:

    • Reconstitution into liposomes for electrophysiological studies

    • Binding studies with known KCNK18 modulators

    • Using pre-coupled magnetic beads for protein interaction studies

How can researchers effectively investigate the role of KCNK18 in neurological disorders beyond migraine?

Recent evidence suggests KCNK18 involvement in multiple neurological conditions beyond migraine. To investigate these broader roles, researchers should consider:

  • Comprehensive mutation screening: Sequence KCNK18 in cohorts with various neurological phenotypes, including:

    • Intellectual disability (ID) and developmental delay (DD)

    • Seizure disorders

    • Autism spectrum disorders

    • Pain sensitivity abnormalities

  • Biallelic vs. heterozygous effects: Analyze both compound heterozygous and homozygous mutations:

    • The biallelic variants approach used to study mild to moderate ID, seizures, and autistic-like behavior

    • Experimental design should mimic compound heterozygous conditions by injecting equal amounts of different mutant mRNAs

  • Brain region-specific effects: Given KCNK18 expression across multiple brain regions (hypothalamus, frontal cortex, hippocampus, etc.) , region-specific knockdown or mutation studies may reveal differential impacts on neurological function.

  • Electrophysiological phenotyping: Characterize how various mutations affect neuronal excitability in relevant models:

    • For migraine: trigeminal ganglion neurons

    • For intellectual disability: cortical and hippocampal neurons

    • For autism: neurons from social behavior circuits

What experimental controls are essential when conducting functional studies with recombinant mouse KCNK18?

Robust experimental design for KCNK18 functional studies requires several critical controls:

  • Expression verification controls:

    • Western blotting to confirm protein expression and size

    • Surface expression confirmation via biotinylation or immunofluorescence

    • Uninjected/mock-transfected cells as negative controls

  • Functional assessment controls:

    • Known functional mutations (e.g., F139WfsX24) as positive controls for loss of function

    • Wild-type KCNK18 as reference for normal channel behavior

    • Un-injected oocytes as background current controls

    • Internal controls for variability in expression systems

  • Pharmacological validation:

    • Potassium channel blockers to confirm K+ current identity

    • Calcineurin inhibitors to validate the phosphorylation-dependent regulation

    • Ionomycin concentration gradients to establish dose-response relationships

How should researchers approach species differences when translating mouse KCNK18 findings to human disease models?

When translating mouse KCNK18 research to human applications, consider:

  • Sequence and structural homology analysis:

    • Perform comparative sequence analysis between mouse and human KCNK18

    • Pay particular attention to conservation in regulatory domains and phosphorylation sites

    • Map disease-associated human mutations onto mouse sequence to ensure functional relevance

  • Expression pattern comparison:

    • Verify that expression patterns in mouse tissues match those in human (particularly in DRG, TG, and CNS regions)

    • Quantify relative expression levels across species using comparable methodologies

  • Functional conservation verification:

    • Conduct parallel functional studies with both mouse and human recombinant proteins

    • Test equivalent mutations in both species to confirm similar electrophysiological consequences

    • Use humanized mouse models for in vivo validation of human mutations

  • Pharmacological response profiling:

    • Compare sensitivity to modulators between species

    • Identify species-specific differences in drug responses

    • Adjust dosing accordingly in translational studies

What are the most reliable methods for quantifying KCNK18 expression in different mouse tissues?

For accurate quantification of KCNK18 expression across tissues:

  • mRNA quantification:

    • Quantitative RT-PCR with carefully validated primers

    • RNA-seq with appropriate depth of coverage for low-abundance transcripts

    • In situ hybridization for spatial expression patterns within tissues

  • Protein detection methods:

    • Western blotting with validated antibodies

    • Immunohistochemistry to visualize cellular and subcellular localization

    • Mass spectrometry for absolute quantification

    • Magnetic bead-coupled antibodies for immunoprecipitation

  • Single-cell approaches:

    • Single-cell RNA-seq to identify cell type-specific expression patterns

    • Patch-seq to correlate electrophysiological properties with expression levels

    • Single-molecule FISH for visualization of mRNA at cellular resolution

  • Reporter systems:

    • Knock-in fluorescent protein fusions

    • Promoter-reporter constructs to monitor expression regulation

    • Conditional expression systems to study temporal dynamics

How can researchers distinguish between primary effects of KCNK18 mutations and secondary compensatory mechanisms?

Differentiating primary from secondary effects requires:

  • Acute vs. chronic manipulation:

    • Acute pharmacological block or rapid genetic techniques (e.g., optogenetics)

    • Comparison with chronic knockout or long-term expression of mutant channels

    • Time-course studies to track progression of phenotypes

  • Pathway analysis:

    • Phosphoproteomic analysis to identify changes in signaling networks

    • Transcriptome analysis to detect compensatory gene expression changes

    • Systematic evaluation of other potassium channels for compensatory upregulation

  • Rescue experiments:

    • Selective restoration of wild-type KCNK18 function in mutant backgrounds

    • Partial agonist/antagonist application to determine dose-dependent effects

    • Targeting downstream pathways to bypass KCNK18 dysfunction

  • Electrophysiological fingerprinting:

    • Comprehensive characterization of neuronal excitability parameters

    • Identification of signature changes specific to KCNK18 dysfunction

    • Comparison with known electrophysiological profiles of other ion channel mutations

What statistical approaches are most appropriate for analyzing electrophysiological data from KCNK18 functional studies?

For robust statistical analysis of KCNK18 electrophysiological data:

  • Sample size determination:

    • Power analysis based on expected effect sizes from preliminary data

    • Consideration of biological variability in expression systems

    • Accounting for multiple comparisons when testing various mutations

  • Normalization strategies:

    • Normalization to cell size (capacitance) for whole-cell recordings

    • Internal controls for expression level variations

    • Paired experimental designs where possible

  • Appropriate statistical tests:

    • One-way ANOVA with post-hoc tests for comparing multiple mutations

    • Repeated measures ANOVA for time-course experiments

    • Non-parametric alternatives when normality cannot be assumed

    • Mixed-effects models for complex experimental designs

  • Reporting standards:

    • Complete reporting of all statistical parameters (F values, degrees of freedom)

    • Graphical representation showing individual data points alongside means

    • Clear indication of statistical significance levels (p < 0.05, p < 0.01, etc.)

What emerging technologies might advance our understanding of KCNK18 function in neurophysiology?

Several cutting-edge approaches show promise for KCNK18 research:

  • Cryo-EM structural studies:

    • Determination of high-resolution KCNK18 structure

    • Visualization of conformational changes during gating

    • Structure-based drug design targeting KCNK18

  • Optogenetic and chemogenetic approaches:

    • Development of light-sensitive KCNK18 variants

    • Chemically-induced dimerization to control channel assembly

    • Spatiotemporally precise modulation of KCNK18 activity in vivo

  • Advanced in vivo imaging:

    • Genetically-encoded voltage indicators paired with KCNK18 expression

    • Calcium imaging in KCNK18-expressing neurons

    • In vivo two-photon imaging of neuronal activity in KCNK18 mutant models

  • Computational modeling:

    • Integration of KCNK18 properties into neuronal network models

    • Prediction of mutation effects on neuronal excitability

    • Simulation of drug effects on KCNK18 function

How can researchers effectively combine in vitro and in vivo approaches to better understand KCNK18's role in complex neurological disorders?

An integrated research strategy should include:

  • Translational pipeline development:

    • Initial identification of variants in patient populations

    • In vitro functional characterization using recombinant systems

    • Generation of knock-in mouse models with equivalent mutations

    • Behavioral and electrophysiological phenotyping of mouse models

    • Correlation with human clinical presentation

  • Physiological relevance assessment:

    • Recording from native neurons expressing endogenous KCNK18

    • Comparison with recombinant channel properties

    • Investigation of cell type-specific effects

    • Evaluation of circuit-level consequences of KCNK18 dysfunction

  • Complementary methodologies:

    • Combining electrophysiology with calcium imaging

    • Pairing behavioral testing with in vivo electrophysiology

    • Using ex vivo brain slice preparations to bridge in vitro and in vivo approaches

    • Applying pharmacological modulators identified in vitro to in vivo models

  • Disease model validation:

    • Cross-validation between different model systems (cells, mice, human samples)

    • Comparison of spontaneous vs. engineered mutations

    • Age-dependent phenotype characterization to capture developmental aspects

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.