Recombinant Mouse Potassium channel subfamily K member 4 (Kcnk4)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Structure of Mouse Kcnk4

Mouse Kcnk4, also known by its synonyms TRAAK, Tex40, TRAAKt, MLZ-622, and Catsperz, belongs to the superfamily of potassium channel proteins containing two pore-forming P domains (K2P) . The gene is identified by Gene ID 16528, with corresponding mRNA reference sequence NM_008431.3 and protein reference sequence NP_032457.1 . Mouse Kcnk4 protein has a molecular mass of approximately 43.1 kDa and functions through homodimerization to form an outwardly rectifying potassium channel . The protein structure features characteristic transmembrane domains that create a channel allowing potassium ions to flow across cellular membranes, contributing to the maintenance of resting membrane potential and cellular excitability . Unlike many other potassium channels, Kcnk4 is classified as voltage-insensitive, meaning its activity is not primarily regulated by changes in membrane potential but rather by other physiological factors .

Mouse Kcnk4 shares significant homology with human KCNK4, which is recognized as part of the TWIK-related arachidonic acid-stimulated two pore potassium channel subfamily . This evolutionary conservation highlights the fundamental importance of this channel across mammalian species. The protein contains specific structural elements that are critical for its function, including helix M4 and M3 regions that play essential roles in the gating mechanism of the channel . Structural analyses have revealed lateral fenestrations in the protein that are involved in controlling potassium flow by allowing lipid access to the central cavity of the channel, representing a unique regulatory mechanism among ion channels .

Comparative Analysis of Mouse and Human Kcnk4

While this report focuses on mouse Kcnk4, it is worth noting the similarities and differences compared to its human ortholog. Human KCNK4 (UniProt ID: Q9NYG8) shares significant sequence homology with mouse Kcnk4 (UniProt ID: O88454), reflecting their conserved functional importance . The human KCNK4 protein consists of 393 amino acids, with a specific sequence that determines its functional properties . Both mouse and human variants of the protein contain two pore-forming domains that create the potassium-selective channel, although species-specific differences in amino acid composition may influence subtle aspects of channel kinetics and regulation . These molecular similarities make mouse Kcnk4 a valuable model for studying the function and pathophysiology of potassium channels in human health and disease.

Production Systems for Recombinant Mouse Kcnk4

Recombinant mouse Kcnk4 protein can be produced using various expression systems, each offering distinct advantages for different research applications. One common approach involves expression in human embryonic kidney 293 (HEK293) cells, which provides a eukaryotic environment conducive to proper protein folding and post-translational modifications . When expressed in HEK293 cells, mouse Kcnk4 is typically fused with tags such as Myc/DDK at the C-terminus to facilitate detection and purification . The resulting recombinant protein maintains its functional characteristics while allowing for easier experimental manipulation and analysis.

Tagging Strategies for Recombinant Mouse Kcnk4

Various tagging approaches have been developed for recombinant mouse Kcnk4 to facilitate detection, purification, and functional studies. Common tags include:

  1. His-tag: A polyhistidine sequence (typically six histidine residues) that allows for metal affinity chromatography purification.

  2. Myc/DDK-tag: Combination tags that enable detection through anti-Myc antibodies and purification via the DDK (FLAG) sequence.

  3. GST-tag: Glutathione S-transferase fusion that can improve solubility while providing an affinity purification method.

  4. His(Fc)-Avi-tag: A complex tag combining histidine, antibody Fc region, and biotinylation capabilities for versatile experimental applications.

Each tagging strategy presents distinct advantages depending on the intended application, although researchers must consider potential impacts on protein structure and function . The choice of tag position (N-terminal versus C-terminal) may also influence protein folding and activity, requiring careful consideration during experimental design.

Functional Properties of Recombinant Mouse Kcnk4

Mouse Kcnk4 functions as a specialized potassium channel with distinct regulatory mechanisms and physiological roles. Unlike voltage-gated potassium channels, Kcnk4 operates as a voltage-insensitive channel whose activity is primarily regulated by mechanical forces that deform the membrane . This mechano-sensitivity makes Kcnk4 particularly important in tissues subject to mechanical stress or pressure changes. Additionally, the channel demonstrates sensitivity to polyunsaturated fatty acids, particularly arachidonic acid, which can stimulate channel opening and enhance potassium conductance . Temperature changes also affect Kcnk4 activity, with increased opening frequency observed at physiological temperatures (37°C) and further enhancement at elevated temperatures (42°C) .

The gating mechanism of Kcnk4 involves a complex conformational transition of helix M4, which controls the access of lipids to the ion conduction pathway . When helix M4 is in a straight configuration (referred to as the "down" state), lipid moieties can insert into lateral fenestrations of the channel, effectively blocking potassium flow and rendering the channel inactive . Conversely, bending of M4 (the "up" conformation) closes these fenestrations, prevents lipid insertion, and leads to a conducting state of the channel . This unique gating mechanism distinguishes Kcnk4 from other potassium channels and contributes to its specialized role in cellular physiology. Research utilizing recombinant mouse Kcnk4 has been instrumental in elucidating these functional properties and understanding the molecular basis of channel regulation.

Electrophysiological Characteristics

Electrophysiological studies of recombinant mouse Kcnk4 have revealed its distinct channel properties. The protein forms functional channels that exhibit outward rectification, meaning they conduct potassium ions more readily in the outward direction (from the cytoplasm to the extracellular space) than inward . This directional preference contributes to its role in cellular excitability and membrane potential regulation. Patch-clamp analyses have demonstrated that Kcnk4 channels contribute to background (leak) potassium currents that help establish the resting membrane potential in excitable cells . The channel exhibits a unitary conductance typical of two-pore domain potassium channels and demonstrates high selectivity for potassium ions over other cations.

Mutations in Kcnk4/KCNK4 can significantly alter channel function, with pathogenic mutations often causing a gain of function that manifests as increased basal activity and impaired sensitivity to mechanical stimulation and arachidonic acid . These functional changes can have profound effects on cellular excitability and signaling, potentially contributing to neurological disorders. The electrophysiological properties of recombinant mouse Kcnk4 are typically characterized using techniques such as whole-cell patch-clamp recording, which allows for detailed analysis of channel kinetics, conductance, and regulation under various experimental conditions.

Tissue Distribution and Physiological Roles

Mouse Kcnk4 demonstrates a selective tissue distribution pattern, with predominant expression in neural tissues . This neural-specific expression profile aligns with its functional roles in regulating neuronal excitability and sensory perception. Within the nervous system, Kcnk4 is expressed in regions involved in sensory processing, including the dorsal root ganglia, where it contributes to the regulation of noxious input threshold . The channel's mechano-sensitivity makes it particularly important in mechanoreception, while its temperature sensitivity suggests involvement in thermosensation.

Research utilizing recombinant mouse Kcnk4 has provided evidence for its role in the perception of pain caused by both heat and pressure stimuli . By modulating membrane potential and neuronal excitability, Kcnk4 influences the threshold for action potential generation in sensory neurons, thereby affecting pain sensation. Beyond its role in sensory perception, Kcnk4 contributes to broader aspects of neuronal function, including the regulation of resting membrane potential and cellular excitability . This background potassium conductance helps maintain proper neuronal signaling and prevents hyperexcitability that could lead to pathological conditions such as epilepsy.

Role in Disease Pathophysiology

Mutations in KCNK4 have been causally linked to a recognizable syndrome characterized by facial dysmorphism, hypertrichosis, epilepsy, intellectual disability/developmental delay, and gingival overgrowth, for which the acronym FHEIG has been proposed . This syndrome highlights the pleiotropic effects of dysregulated KCNK4 function across multiple physiological systems. Molecular dynamics simulations indicate that disease-causing mutations favor the sealing of lateral intramembrane fenestrations, which normally negatively control potassium flow by allowing lipid access to the central cavity of the channel . This structural alteration results in a gain-of-function effect with significant pathophysiological consequences.

Co-expression experiments have demonstrated the dominant behavior of disease-causing mutations, suggesting that even heterozygous alterations can significantly impact channel function and cellular physiology . The involvement of Kcnk4 in this distinct clinical syndrome underscores its importance in normal development and neurological function. Research using recombinant mouse Kcnk4 continues to elucidate the molecular mechanisms underlying these pathological conditions, potentially identifying targets for therapeutic intervention.

Research Applications of Recombinant Mouse Kcnk4

Recombinant mouse Kcnk4 serves numerous research applications in neuroscience, physiology, and pharmacology. Key applications include:

  1. Structural biology studies: Recombinant protein enables detailed analysis of channel structure using techniques such as X-ray crystallography and cryo-electron microscopy.

  2. Electrophysiological investigations: Purified protein can be reconstituted into artificial membranes or expressed in cell lines for patch-clamp studies of channel properties.

  3. Drug discovery: Recombinant Kcnk4 facilitates high-throughput screening of potential modulators that could have therapeutic applications.

  4. Antibody production: The protein serves as an immunogen for generating specific antibodies against Kcnk4 for research and diagnostic applications .

  5. Protein-protein interaction studies: Tagged versions of recombinant Kcnk4 enable investigation of molecular interactions with regulatory proteins or other cellular components.

These research applications have significantly advanced our understanding of potassium channel biology and the specific roles of Kcnk4 in physiological and pathological processes . Continued refinement of recombinant protein production methods promises to further expand the utility of mouse Kcnk4 in biomedical research.

Analytical Methods for Studying Recombinant Mouse Kcnk4

Various analytical techniques have been developed to study the properties and functions of recombinant mouse Kcnk4. Western blotting using specific antibodies represents a commonly employed method for detecting and quantifying the protein in experimental samples . Commercial antibodies against mouse Kcnk4, including recombinant chimeric rabbit antibodies derived from mouse IgG1 formats, are available to support such analyses . These antibodies bind specifically to Kcnk4/TRAAK and can be used in various immunological techniques beyond Western blotting, such as immunohistochemistry and immunoprecipitation.

Enzyme-linked immunosorbent assay (ELISA) provides another valuable approach for detecting and quantifying recombinant mouse Kcnk4 in experimental samples . This sensitive technique allows for measurement of protein concentration and can be used to assess protein-protein interactions or binding of potential modulatory compounds. Electrophysiological techniques, particularly patch-clamp analysis, remain the gold standard for functional characterization of ion channels including Kcnk4 . These approaches enable detailed investigation of channel kinetics, conductance, and response to various stimuli including mechanical forces, temperature changes, and chemical modulators.

Advanced Techniques for Functional Analysis

Beyond conventional methods, advanced techniques have been applied to study recombinant mouse Kcnk4:

  1. Molecular dynamics simulations have provided insights into the conformational changes associated with channel gating, particularly focusing on the movement of helix M4 and its impact on lateral fenestrations .

  2. High-resolution structural techniques, including X-ray crystallography and cryo-electron microscopy, have elucidated the three-dimensional arrangement of Kcnk4, contributing to our understanding of structure-function relationships.

  3. Site-directed mutagenesis approaches, combined with functional assays, have identified key residues involved in channel regulation and gating, such as Ala244 in helix M4 and Ala172 in M3 .

  4. Co-expression studies with wild-type and mutant forms of Kcnk4 have revealed dominant effects of pathogenic mutations and provided insights into channel assembly and subunit interactions .

These sophisticated analytical approaches have significantly advanced our understanding of Kcnk4 function and its role in health and disease. The availability of well-characterized recombinant mouse Kcnk4 has been instrumental in facilitating these investigative techniques.

Future Research Directions and Therapeutic Potential

Future research involving recombinant mouse Kcnk4 holds promise for advancing both basic science understanding and therapeutic applications. One important direction involves the development of specific modulators (activators or inhibitors) of Kcnk4 that could have therapeutic value in treating conditions associated with channel dysfunction. Given the role of Kcnk4 in pain perception, such modulators might offer novel approaches to pain management, particularly for mechanical and thermal hypersensitivity . The gain-of-function mutations observed in FHEIG syndrome suggest that Kcnk4 inhibitors might provide therapeutic benefit for affected individuals, potentially addressing symptoms such as epilepsy and developmental delays .

Further structural studies of recombinant mouse Kcnk4 will likely refine our understanding of the gating mechanism, particularly the role of lateral fenestrations and lipid interactions in regulating channel activity . Such insights could inform rational drug design efforts targeting specific conformational states or regulatory mechanisms. Additionally, investigation of how Kcnk4 interacts with other membrane components, including lipids and associated proteins, will provide a more comprehensive understanding of its regulation in the complex cellular environment. These studies may reveal new regulatory mechanisms and potential therapeutic targets.

Translational Research Implications

Translational research utilizing recombinant mouse Kcnk4 may bridge fundamental scientific discoveries with clinical applications. The development of mouse models expressing mutant forms of Kcnk4 that mimic human disease-causing mutations could provide valuable systems for testing potential therapeutic interventions . Such models would allow for assessment of both efficacy and safety in a physiologically relevant context before advancing to human studies. Additionally, screening chemical libraries against recombinant mouse Kcnk4 could identify lead compounds for drug development, targeting either gain- or loss-of-function conditions depending on the therapeutic goal.

Given the critical role of Kcnk4 in neuronal function, its modulation might have applications beyond the specific syndrome associated with KCNK4 mutations. For example, conditions characterized by neuronal hyperexcitability, such as certain forms of epilepsy or neuropathic pain, might benefit from therapies targeting Kcnk4 activity . The continued refinement of recombinant protein production methods, combined with advances in structural biology and drug discovery technologies, promises to accelerate progress in this field and potentially lead to new therapeutic options for patients with relevant conditions.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate them in your order notes, and we will prepare the product according to your demand.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery information.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing of the protein is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. To enhance long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a reference point.
Shelf Life
The shelf life of the protein is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. Lyophilized protein maintains a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the protein at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles to maintain protein integrity.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Kcnk4; Traak; Potassium channel subfamily K member 4; TWIK-related arachidonic acid-stimulated potassium channel protein; TRAAK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-398
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Kcnk4
Target Protein Sequence
MRSTTLLALLALVLLYLVSGALVFQALEQPHEQQAQKKMDHGRDQFLRDHPCVSQKSLED FIKLLVEALGGGANPETSWTNSSNHSSAWNLGSAFFFSGTIITTIGYGNIVLHTDAGRLF CIFYALVGIPLFGMLLAGVGDRLGSSLRRGIGHIEAIFLKWHVPPGLVRSLSAVLFLLIG CLLFVLTPTFVFSYMESWSKLEAIYFVIVTLTTVGFGDYVPGDGTGQNSPAYQPLVWFWI LFGLAYFASVLTTIGNWLRAVSRRTRAEMGGLTAQAASWTGTVTARVTQRTGPSAPPPEK EQPLLPSSLPAPPAVVEPAGRPGSPAPAEKVETPSPPTASALDYPSENLAFIDESSDTQS ERGCALPRAPRGRRRPNPSKKPSRPRGPGRLRDKAVPV
Uniprot No.

Target Background

Function
TRAAK is a voltage-insensitive potassium channel. Its activation is triggered by mechanical forces that deform the membrane or by raising the intracellular pH to basic levels. The channel exhibits inactivity at 24 degrees Celsius (in vitro). Increasing the temperature to 37 degrees Celsius enhances the frequency of channel opening, with further increased activity observed at 42 degrees Celsius. TRAAK plays a crucial role in the sensory perception of pain caused by pressure and heat.
Gene References Into Functions
  1. The beneficial effects of TRAAK deletion suggest its potential as a pharmacological target for stroke treatment. PMID: 23285272
  2. TRAAK appears to be significantly involved in regulating airway mechanosensing, as it is expressed on the terminals of all subpopulations of potential vagal mechanosensors. PMID: 21822716
Database Links
Protein Families
Two pore domain potassium channel (TC 1.A.1.8) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in brain, spinal cord and eye. Not detected in heart, skeletal muscle, liver, lungs, kidney and testis.

Q&A

What is the structure and function of mouse Kcnk4?

Mouse Kcnk4 (also known as TRAAK) belongs to the mechano-gated ion channels of the TRAAK/TREK subfamily of two-pore-domain (K2P) potassium channels. It features a unique structure with four transmembrane domains and two pore-forming loops. The channel contains lateral intramembrane fenestrations that regulate K+ flow by allowing lipid access to the central cavity of the channel . TRAAK channels primarily function to establish resting membrane potential and regulate cellular excitability, contributing to the background "leak" K+ current in various tissues, particularly in the nervous system . The channel is activated by mechanical stimuli, arachidonic acid, and certain lipids, allowing it to serve as a cellular mechanosensor.

What expression systems are most reliable for recombinant mouse Kcnk4 studies?

For recombinant mouse Kcnk4 expression, Chinese Hamster Ovary (CHO) cells are frequently used due to their low endogenous K+ channel expression and high transfection efficiency . Methodology typically involves:

  • Cloning mouse Kcnk4 cDNA into an appropriate expression vector (e.g., pcDNA3)

  • Transfecting cells using Lipofectamine 2000 or similar reagents (recommended concentration: 400 ng/mL for single expression studies or 80 ng/mL when co-expressed with other constructs)

  • Co-transfecting with a reporter gene (such as EGFP) to identify successfully transfected cells

  • Allowing 24-48 hours for robust channel expression before functional studies

For more physiologically relevant studies, primary neuronal cultures or Xenopus oocytes can be used, though these systems may present additional technical challenges.

What are the standard electrophysiological protocols for characterizing Kcnk4 function?

Patch-clamp electrophysiology remains the gold standard for functional characterization of recombinant Kcnk4 channels. The following protocols are recommended:

Whole-cell configuration:

  • Holding potential: -80 mV

  • Voltage steps: from -100 mV to +80 mV (20 mV increments)

  • Voltage ramps: from -100 mV to +100 mV (duration 500 ms)

  • Sampling rate: 10 kHz with 3 kHz filtering

  • External solution: 150 mM NaCl, 5 mM KCl, 1 mM MgCl2, 2 mM CaCl2, 10 mM HEPES (pH 7.4)

  • Internal solution: 140 mM KCl, 5 mM EGTA, 5 mM HEPES (pH 7.3)

Outside-out configuration (for mechanosensitivity studies):

  • Apply positive pressure through the patch pipette (5-30 mmHg)

  • Monitor current at 0 mV and K+ conductance at -80 mV

  • Repeated mechanical stimulation often increases channel activation with wild-type channels

Results typically show outward-rectifying currents in cells expressing wild-type Kcnk4, which become more pronounced at positive potentials and can increase substantially with mechanical stimulation .

How do gain-of-function mutations in Kcnk4 affect channel gating properties?

Gain-of-function mutations in Kcnk4 significantly alter channel gating properties through structural mechanisms that can be quantified electrophysiologically. Based on studies of human KCNK4 mutations (which have mouse homologs), these changes include:

  • Increased basal channel activity: Mutations like p.Ala172Glu and p.Ala244Pro result in substantially larger membrane currents even in the absence of channel-activating stimuli

  • Altered voltage dependence: Mutant channels show prominent currents in the negative potential range, whereas wild-type channels primarily conduct at positive potentials

  • Impaired mechanosensitivity: While wild-type channels can be activated up to 100-fold by mechanical stimulation in outside-out patches, mutant channels show limited or absent responses to pressure application

  • Dominant effect in heteromeric channels: Co-expression of mutant and wild-type Kcnk4 results in significantly increased current amplitudes compared to wild-type channels alone, indicating a dominant effect of the mutations

The table below summarizes the electrophysiological differences between wild-type and mutant Kcnk4 channels:

ParameterWild-type Kcnk4Mutant Kcnk4 (e.g., p.Ala244Pro)
Basal current at -80 mVLowSignificantly elevated
Voltage-dependent activationPronounced at positive potentialsMinimal voltage dependence
Response to mechanical stimulationUp to 100-fold increaseLimited or absent response
Current reversal potentialNear -80 mVPreserved (near -80 mV)

What molecular mechanisms explain how Kcnk4 mutations affect channel function?

Molecular dynamics simulations have revealed specific structural mechanisms by which mutations affect Kcnk4 channel function. These mechanisms primarily involve the lateral intramembrane fenestrations that control K+ flow:

  • In wild-type Kcnk4, the M4 helix can transition between "up" and "down" conformations. Under normal conditions (without activating stimuli), the M4_B helix tends to evolve toward the down conformation, which restricts K+ flow

  • Mutations like p.Ala172Glu and p.Ala244Pro appear to favor sealing of the lateral intramembrane fenestration, preventing lipid access to the central cavity

  • This structural alteration promotes an activated channel state even in the absence of mechanical stimulation or other activating factors

  • The conformational changes likely explain both the increased basal activity and the reduced sensitivity to mechanical stimulation observed in mutant channels

These findings support the gating mechanism hypothesis based on the lateral fenestrations of K2P channels, where lipid access through these fenestrations negatively regulates channel activity.

How can researchers distinguish between primary Kcnk4 effects and compensatory mechanisms in experimental models?

Distinguishing primary Kcnk4 effects from compensatory mechanisms requires a multi-faceted experimental approach:

  • Acute vs. chronic manipulations:

    • Acute: Use rapid techniques like optogenetic control or fast-acting pharmacological tools

    • Chronic: Compare with genetic models (knockouts, knock-ins) for long-term adaptations

  • Time-course studies:

    • Monitor changes in cellular/tissue function at multiple time points after Kcnk4 manipulation

    • Early changes (minutes to hours) more likely represent direct effects

    • Later changes (days to weeks) may involve compensatory mechanisms

  • Combined electrophysiology and molecular approaches:

    • Parallel patch-clamp recordings with transcriptomics/proteomics

    • Identify changes in expression of other ion channels or regulatory proteins

  • Pharmacological isolation:

    • Use specific blockers for other ion channels to isolate Kcnk4 contribution

    • Apply specific activators (mechanical stimulation, arachidonic acid) to probe Kcnk4 function

  • Dominant negative approaches:

    • Co-express wild-type and mutant Kcnk4 at different ratios (e.g., 80 ng/mL each)

    • Analyze how functional properties change with different expression ratios

What is the relationship between Kcnk4 dysfunction and neurological disorders?

Kcnk4 dysfunction has been implicated in several neurological disorders, with specific mechanisms emerging from recent research:

  • Epilepsy: Gain-of-function mutations in KCNK4 can cause a recognizable syndrome including epilepsy . These mutations likely contribute to epileptogenesis through:

    • Hyperpolarization of the resting membrane potential

    • Altered neuronal excitability

    • Disrupted network synchronization

  • Neurodevelopmental disorders: KCNK4 mutations can cause intellectual disability and developmental delay , possibly through:

    • Altered neuronal migration during development

    • Disrupted synaptogenesis

    • Impaired neuronal maturation

  • Complex phenotypes: The FHEIG syndrome (facial dysmorphism, hypertrichosis, epilepsy, intellectual disability/developmental delay, and gingival overgrowth) demonstrates the pleiotropic effects of dysregulated KCNK4 function

  • Potential interaction with other channelopathies: Some evidence suggests that KCNK4 mutations may interact with variants in other ion channel genes, potentially causing more severe phenotypes than single gene mutations alone . The products of SCN8A and KCNK4 may interact indirectly via mutual genes such as KCNQ2 and KCNQ3, as well as through global interactions between sodium channels, voltage-gated potassium channels, and other regulatory proteins .

How can arachidonic acid sensitivity be used to probe Kcnk4 function in experimental models?

Arachidonic acid (AA) sensitivity provides a valuable tool for probing Kcnk4 function in various experimental models:

  • Experimental protocol for AA sensitivity testing:

    • Prepare AA stock solution in ethanol (10-100 mM)

    • Dilute to working concentrations (1-10 μM) immediately before use

    • Apply via perfusion system or direct addition to bath

    • Monitor channel activity using patch-clamp electrophysiology

    • Compare responses to standardized voltage protocols before and after AA application

  • Quantitative assessment of AA sensitivity:

    • Calculate percent increase in current amplitude at defined voltages

    • Determine EC50 values through concentration-response curves

    • Compare activation kinetics pre- and post-AA application

  • Wild-type vs. mutant channel comparison:

    • Wild-type mouse Kcnk4 typically shows robust activation by AA

    • Gain-of-function mutants (e.g., equivalents of human p.Ala172Glu, p.Ala244Pro) show impaired AA sensitivity

    • This differential response can help identify functional consequences of novel Kcnk4 variants

  • Tissue-specific considerations:

    • Neuronal preparations may have confounding effects due to AA metabolism

    • Heterologous expression systems provide cleaner AA response data

    • Primary cultured neurons may better reflect physiological relevance

What are the key considerations for generating reliable mouse models of Kcnk4 dysfunction?

Creating reliable mouse models of Kcnk4 dysfunction requires careful attention to several factors:

  • Selection of genetic modification approach:

    • Knockout models: Useful for complete loss-of-function studies

    • Knock-in models: Essential for studying specific mutations (e.g., gain-of-function variants)

    • Conditional models: Allow tissue-specific or temporal control of Kcnk4 expression

  • Genetic background considerations:

    • Use pure genetic backgrounds where possible (C57BL/6J recommended)

    • Control for potential modifier genes by backcrossing

    • Include littermate controls in all experiments

  • Validation of model fidelity:

    • Confirm genetic modification by sequencing

    • Verify altered Kcnk4 expression at mRNA and protein levels

    • Validate functional changes using electrophysiology

  • Phenotypic characterization:

    • Comprehensive behavioral testing (cognition, seizure susceptibility)

    • EEG monitoring for spontaneous seizures

    • Histological assessment for developmental abnormalities

  • Experimental controls for mechanistic studies:

    • Include pharmacological validation (Kcnk4 modulators)

    • Compare phenotypes with other K+ channel mouse models

    • Consider rescue experiments (e.g., viral re-expression of wild-type Kcnk4)

What are the optimal methods for assessing Kcnk4 mechanosensitivity in different experimental preparations?

Mechanosensitivity is a key property of Kcnk4 channels that requires specialized techniques for accurate assessment:

  • Patch-clamp approaches:

    • Outside-out patches: Apply precisely controlled positive pressure (5-30 mmHg) through the patch pipette while monitoring currents

    • Cell-attached configuration: Apply negative pressure (suction) to the patch

    • Whole-cell mode: Provides baseline data without mechanical stimulation as this configuration exerts no tension on the cell membrane

  • Specialized equipment:

    • High-precision pressure clamp systems (e.g., HSPC-1 from ALA Scientific)

    • Piezoelectric devices for membrane stretch

    • Automated pressure application protocols for reproducibility

  • Analytical considerations:

    • Measure both initial response and adaptation to sustained stimulation

    • Calculate pressure-response relationships (current vs. pressure)

    • Report maximum fold-increase in current (wild-type KCNK4 can show up to 100-fold increases)

  • Comparative protocols:

    • For wild-type Kcnk4: Test repeated mechanical stimulations as effects often increase with repetition and time

    • For mutant channels: Compare initial current amplitude and pressure-induced changes to wild-type

    • Report both absolute current values and fold-change with stimulation

How can researchers address technical challenges in studying Kcnk4 interactions with other cellular components?

Studying Kcnk4 interactions with other cellular components presents several technical challenges that can be addressed through specialized approaches:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation with antibodies against Kcnk4

    • Proximity ligation assays for detecting in situ interactions

    • FRET/BRET approaches for real-time interaction monitoring

    • Mass spectrometry for unbiased identification of interaction partners

  • Lipid-channel interactions:

    • Native mass spectrometry to preserve lipid-protein complexes

    • Lipid binding assays with purified recombinant protein

    • Molecular dynamics simulations focusing on the lateral fenestrations

    • Reconstitution in artificial membranes with defined lipid composition

  • Channel complex stoichiometry:

    • Single-molecule fluorescence techniques

    • Blue native PAGE for intact complex analysis

    • Subunit counting approaches for heteromeric channels

  • Dynamic interactions during gating:

    • Voltage-clamp fluorometry

    • Site-directed fluorescence quenching

    • Cysteine accessibility studies during different gating states

  • Interaction with cytoskeleton:

    • Live-cell imaging combined with cytoskeletal disrupting agents

    • Single-channel recordings during cytoskeletal manipulation

    • Correlative electron microscopy for structural context

How should researchers analyze complex electrophysiological data from Kcnk4 experiments?

Analysis of complex electrophysiological data from Kcnk4 experiments requires systematic approaches:

  • Current-voltage relationship analysis:

    • Plot I-V curves for steady-state currents

    • Calculate slope conductance at physiologically relevant voltages (-80 mV is particularly important for Kcnk4)

    • Determine reversal potential to confirm K+ selectivity (should be near -80 mV)

  • Kinetic analysis:

    • Measure activation and deactivation time constants

    • Analyze response to rapid voltage changes

    • Quantify adaptation to sustained stimuli

  • Mechanosensitivity metrics:

    • Calculate fold-increase in current with mechanical stimulation

    • Determine pressure threshold for activation

    • Assess maximum response and pressure at half-maximal activation

  • Statistical considerations:

    • Use paired analyses when comparing before/after interventions

    • Report both mean ± SEM and individual data points

    • Consider normalized data when comparing across experiments

  • Advanced computational approaches:

    • Markov modeling of channel gating states

    • Hidden Markov Model analysis of single-channel data

    • Machine learning for pattern recognition in complex responses

What are the best practices for interpreting conflicting data regarding Kcnk4 function in different systems?

Researchers frequently encounter conflicting results when studying Kcnk4 across different experimental systems. Best practices for interpretation include:

  • Systematic comparison of methodological differences:

    • Expression levels (quantify using Western blot or qPCR)

    • Recording conditions (solutions, temperature, etc.)

    • Cell types (heterologous vs. native)

    • Species differences (mouse vs. human)

  • Context-dependent interpretation:

    • Consider cellular background (presence of interacting proteins)

    • Evaluate post-translational modifications in different systems

    • Assess lipid environment variations

  • Reconciliation strategies:

    • Conduct side-by-side experiments in multiple systems

    • Develop mathematical models that account for system-specific factors

    • Use rescue experiments to confirm causal relationships

  • Example of systematic interpretation:
    When interpreting differential drug responses in Kcnk4 variants, consider:

    • Different variants may show variable responses to the same drug

    • Same variant may respond differently to different channel blockers

    • For instance, some SCN8A-related epilepsies (which can interact with KCNK4 variants) respond favorably to levetiracetam despite this typically aggravating seizures in most cases

How can bioinformatic prediction tools be utilized to assess novel Kcnk4 variants?

Bioinformatic prediction tools provide valuable initial assessments of novel Kcnk4 variants, though functional validation remains essential:

  • Recommended prediction algorithms:

    • PolyPhen-2: Evaluates potential impact on protein structure and function

    • SIFT: Predicts if amino acid substitutions affect protein function

    • MutationTaster: Evaluates disease-causing potential

    • Align-GVGD: Classifies variants based on biochemical properties

  • Integrating multiple predictions:
    Below is an example table showing how to integrate predictions for novel variants (based on analysis approach used for KCNK4 variants in humans) :

    VariantPolyPhen-2Align-GVGDSIFTMutationTasterConsensus
    Example variant 1Probably damagingC15ToleratedDisease causingLikely pathogenic
    Example variant 2Probably damagingC0DeleteriousDisease causingLikely pathogenic
  • Conservation analysis:

    • Evaluate conservation across species using multiple sequence alignment

    • Assess domain-specific conservation (pore regions, fenestrations)

    • Consider both strict conservation and conservative substitutions

  • Structural context evaluation:

    • Map variants onto available crystal structures

    • Assess proximity to functional domains (pore, fenestrations)

    • Use molecular dynamics simulations to predict structural impacts

  • Limitation awareness:

    • Predictions may conflict (as seen with some KCNK4 variants)

    • In silico predictions should guide, not replace, functional studies

    • Novel variants in highly conserved domains warrant particular attention even with ambiguous predictions

What are the most promising approaches for developing selective Kcnk4 modulators for research applications?

Development of selective Kcnk4 modulators would greatly enhance research capabilities:

  • Structure-based drug design:

    • Utilize crystal structures of Kcnk4 and related K2P channels

    • Focus on unique structural features like lateral fenestrations

    • Design compounds that stabilize specific conformational states

  • High-throughput screening strategies:

    • Fluorescence-based membrane potential assays

    • Automated electrophysiology platforms

    • Yeast-based K+ transport complementation systems

  • Mechanosensitivity-targeted compounds:

    • Develop molecules that modify channel response to mechanical stimuli

    • Focus on compounds that interact with the sensor domains

  • Potential therapeutic applications:

    • Activators for treating hyperexcitability disorders

    • Inhibitors for conditions with gain-of-function mutations

    • State-dependent modulators for selective targeting

  • Delivery considerations for research tools:

    • Cell-permeable small molecules

    • Photoactivatable caged compounds

    • Genetically encoded modulators for cell-type specificity

How might research on Kcnk4 contribute to understanding broader mechanisms of ion channel regulation?

Research on Kcnk4 offers unique insights into several fundamental aspects of ion channel biology:

  • Mechanosensation mechanisms:

    • Kcnk4 provides a model system for studying how membrane tension is converted to channel gating

    • Insights may be applicable to other mechanosensitive channels

  • Lipid-protein interactions:

    • The lateral fenestration gating mechanism of Kcnk4 exemplifies how lipids can directly regulate ion channels

    • This mechanism may represent a broader paradigm in membrane protein regulation

  • Channelopathy synergism:

    • The interaction between Kcnk4 and other channel mutations (e.g., SCN8A) demonstrates how multiple channelopathies can synergize

    • This may explain variable expressivity and incomplete penetrance in ion channel disorders

  • Structural dynamics of ion channels:

    • Conformational changes in Kcnk4 highlight the importance of protein dynamics in channel function

    • Molecular dynamics simulations of Kcnk4 variants provide testable hypotheses about structure-function relationships

  • Therapeutic paradigms:

    • Understanding how specific Kcnk4 mutations alter channel function informs targeted therapeutic approaches

    • May lead to mutation-specific treatment strategies for channelopathies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.