Recombinant Mouse Potassium voltage-gated channel subfamily A member 1 (Kcna1)

Shipped with Ice Packs
In Stock

Description

Production Methods

Recombinant Mouse Kcna1 is synthesized using heterologous expression systems:

Expression SystemHost CellPurification TagKey Features
Plant-basedNicotiana tabacum (tobacco)Strep-tagCost-effective for large-scale production; retains native folding .
MammalianHEK293, CHO cellsNonePreserves post-translational modifications; used for electrophysiology studies .
In vitro cell-freeWheat germ extractGST, HisRapid production for structural studies .

Production in tobacco avoids mammalian glycosylation patterns, simplifying functional studies of ion channel core properties .

Functional Properties

Recombinant Kcna1 channels exhibit delayed rectifier potassium currents with:

  • Activation threshold: -50 mV to +70 mV .

  • Slow C-type inactivation kinetics (~100–500 ms) influenced by glycosylation status .

  • Homo- and heterotetrameric assembly with other Kv1 subunits (e.g., Kv1.2, Kv1.4) .

Glycosylation-deficient mutants (e.g., Kv1.1N207Q) show:

  • Positively shifted voltage dependence (+10 mV)

  • Slowed activation kinetics (τ increased by 30–50%)

Epilepsy and Hyperexcitability Studies

  • Knockout mouse models: Kcna1 deletion causes spontaneous seizures and hippocampal neurodegeneration, mimicking temporal lobe epilepsy .

  • Gene therapy: Viral vector-mediated Kcna1 delivery reduces seizure frequency in knockout mice .

Channelopathy Investigations

  • Episodic ataxia type 1 (EA1): Over 17 pathogenic Kcna1 variants have been linked to EA1 and epilepsy, with pore-region mutations strongly associated with seizures .

  • Autoimmune disorders: Anti-Kv1.1 antibodies (e.g., K36/15) are used to study Isaacs syndrome pathogenesis .

Electrophysiological Profiling

Recombinant Kcna1 is critical for:

  • Screening small molecules targeting Kv1.1-containing channels .

  • Studying β-subunit interactions (e.g., KCNAB2) that modulate inactivation .

Challenges and Limitations

  • Expression variability: Heterologous systems like CHO cells show inconsistent infection rates (e.g., 44–237 cells per condition) .

  • Glycosylation artifacts: Mammalian cell-derived Kcna1 may not fully replicate neuronal channel properties .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we currently have in stock, we are happy to accommodate any specific format requirements. Please indicate your preference in the order notes and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: Our standard shipping method includes normal blue ice packs. If dry ice is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, briefly centrifuge the vial prior to opening to ensure the contents settle at the bottom. We recommend reconstituting the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
Kcna1; Potassium voltage-gated channel subfamily A member 1; MBK1; MKI; Voltage-gated potassium channel subunit Kv1.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-495
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Kcna1
Target Protein Sequence
MTVMSGENADEASTAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPN TLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFY ELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILIS IVIFCLETLPELKDDKDFTGTIHRIDNTTVIYTSNIFTDPFFIVETLCIIWFSFELVVRF FACPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQEGNQKGEQATSLAILRVIRLVRVF RIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEAESHFSSIP DAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE GEEQAQLLHVSSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIRTGNCTT ADQNCVNKSKLLTDV
Uniprot No.

Target Background

Function
Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes. Primarily found in the brain and central nervous system, but also in the kidney. Plays a crucial role in regulating membrane potential, nerve signaling, and preventing neuronal hyperexcitability. Forms tetrameric potassium-selective channels that facilitate the passage of potassium ions in accordance with their electrochemical gradient. The channel transitions between open and closed conformations in response to voltage changes across the membrane. Can form functional homotetrameric channels and heterotetrameric channels with variable proportions of KCNA1, KCNA2, KCNA4, KCNA5, KCNA6, KCNA7, and potentially other family members. Channel properties are influenced by the specific alpha subunits present. Cytoplasmic beta subunits modulate channel properties by regulating the subcellular location of alpha subunits and promoting rapid inactivation of delayed rectifier potassium channels. In vivo, membranes likely contain a mix of heteromeric potassium channel complexes, making it challenging to attribute specific currents in intact tissues to any particular potassium channel family member. Homotetrameric KCNA1 forms a delayed-rectifier potassium channel that opens in response to membrane depolarization followed by slow spontaneous channel closure. In contrast, heterotetrameric channels formed by KCNA1 and KCNA4 demonstrate rapid inactivation. Regulates neuronal excitability in the hippocampus, particularly in mossy fibers and medial perforant path axons, preventing neuronal hyperexcitability. May function as a downstream effector for G protein-coupled receptors and inhibit GABAergic inputs to basolateral amygdala neurons. May contribute to the regulation of neurotransmitter release, including gamma-aminobutyric acid (GABA) release. Plays a role in regulating action potential generation and preventing hyperexcitability in myelinated axons of the vagus nerve, thereby contributing to heart contraction regulation. Required for normal neuromuscular responses. Regulates the frequency of neuronal action potential firing in response to mechanical stimuli, contributing to the perception of pain caused by mechanical stimuli, but not heat stimuli. Essential for normal responses to auditory stimuli and precise sound source localization, but not for sound perception. Toxins that block specific channels suggest that this protein contributes to the regulation of dopamine release. Required for normal postnatal brain development and neuronal precursor cell proliferation in the brain. Plays a role in Mg(2+) reabsorption in the distal convoluted tubules of the kidney and magnesium ion homeostasis, potentially through its impact on membrane potential.
Gene References Into Functions
  1. KCNQ activation significantly decreased seizure latency by >/=50% in Kcnq1 strain mice, but had no effect in the Kcna1 strain. However, in simultaneous EEG and ECG recordings, KCNQ activation markedly reduced spontaneous seizure frequency in Kcna1-/- mice by approximately 60%. In Kcnq1 mice, KCNQ activation produced adverse cardiac effects including significant bradycardia and abnormal increases in heart rate variability and AV conduction blocks. PMID: 29265344
  2. Kcna1(-/-) mice, a model for sudden unexpected death in epilepsy, exhibited increased basal respiratory drive, chronic oxygen desaturation, frequent apnea-hypopnea (A-H), an atypical breathing sequence of A-H-tachypnea-A-H, increased tidal volume, and hyperventilation induced by methacholine. PMID: 29327348
  3. The pore-forming subunit of the large conductance voltage and calcium-activated potassium (BK, Slo1, or KCa1.1) channels encoded by a single KCa1.1 gene assembles in a fourfold symmetric fashion. Functional diversity arises from two families of regulatory subunits, beta and gamma, which help define the range of voltages over which BK channels in a given cell are activated, thereby defining physiological roles PMID: 30224470
  4. This study suggests that accumulated rest deficiency is associated with sudden death in Kv1.1 KO mice. PMID: 29193044
  5. No evidence has been found for developmental compensation of inherited Kv1.1 dysfunction in a mouse model of presynaptic channelopathy. PMID: 27381274
  6. Kv1.1 defects abolish presynaptic spike width modulation by subthreshold somatic depolarization. PMID: 28193892
  7. Low-voltage-activated K(+) (gKL) and hyperpolarization-activated mixed cation conductances (gh) mediate currents, IKL and Ih, through channels of the Kv1 (KCNA) and HCN families respectively and give auditory neurons the temporal precision required for signaling information about the onset, fine structure, and time of arrival of sounds. PMID: 28065805
  8. This study identifies Kvbeta1.1 as a sensor of pyridine nucleotide changes and as a modulator of Kv4.2 gating, action potential duration, and ECG in the mouse heart. PMID: 27986658
  9. This study provides new insights into the dynamic and differential distribution of Kv1 channels and associated proteins during myelination. PMID: 26840208
  10. Age-associated changes in Sphingolipid composition or CerS2 ablation upregulate K(Ca) 1.1 and impair Ca(2+) mobilization, which thereby induces contractile dysfunction of gastric smooth muscle. PMID: 26288989
  11. Kcna-1 null mice initially expressed only a few of the most severe seizure types that progressively increased in frequency and decreased in seizure severity PMID: 26724401
  12. Kv1.2 channels represent an important physiological link in electric field-induced cell migration. PMID: 26580832
  13. Spontaneous seizures in Kcna1-null mice activate Fos expression in select limbic circuits PMID: 26112121
  14. Data suggest that the behavioral effect of Kv1.1 deletion is primarily to impede binaural integration and thus to mimic monaural hearing. PMID: 25602577
  15. The Kv1.1 null mouse is a potential model for sudden unexpected death in epilepsy in patients PMID: 25377007
  16. Kv1.1 is modulated by ANK3 in conditions of high dietary magnesium PMID: 23903368
  17. Heterozygous mice subjected to P6 hypoxia exhibit increased susceptibility to flurothyl-induced seizures PMID: 24032507
  18. These data indicate that loss of Kv1.1 enhances synaptic release in the CA3 region, which reduces spike timing precision of individual neurons leading to disorganization of network oscillatory activity and promotes the emergence of fast ripples. PMID: 23466697
  19. Kv1.1 acts as a mechanosensitive brake that regulates mechanical sensitivity of fibers associated with mechanical perception PMID: 23473320
  20. It was concluded that Kv1.1-deficiency causes hyperexcitability in large myelinated axons in vagus nerve which could contribute to autonomic dysfunction in Kcna1-null mice, and that KCNQ openers reveals synergy between Kv1 and KCNQ channels. PMID: 22641786
  21. This study highlights that juxtaparanodal K(+) channels composed of Kv1.1 subunits play a significant role in dampening the excitability of motor nerve axons during fatigue or ischemic insult. PMID: 22609489
  22. Mechanisms for processing acoustic transients are less effective in Kcna1 -/- mice PMID: 22302114
  23. Overlapping patterns with differential expression and precise localization of Kv1.1 and Kv1.2 channels targeted to specialized subcellular compartments contribute to distinctive patterns of neuronal excitability --REVIEW PMID: 22612818
  24. Suprathreshold auditory evoked potentials coupled with their normal thresholds suggest that a disruption in central neural processing in Kcna1 null mice and not peripheral hearing loss is responsible for their poor sound localization. PMID: 22396426
  25. The BK channels in parotid acinar cells have a much more hyperpolarized voltage activation range than BK channels in most other cell types, attributable to an accessory protein, LRRC26, which is expressed in parotid glands. PMID: 21984254
  26. K(Ca)1.1-mediated K(+) secretion mainly occurs in the crypts of the murine distal colon. PMID: 21822598
  27. These results imply a fundamental role for Kv1.1 in temporal integration of excitation and inhibition during sound source localization. PMID: 21224222
  28. Kv1.1 channels are expressed in the beta-cells of several species PMID: 21483673
  29. Found that the shifted activation of parotid BK channels resulted from a hyperpolarizing shift of the voltage dependence of voltage sensor activation and channel opening and included a large change in the coupling of these two processes. PMID: 20519930
  30. Data suggest that Kv1.1 deficiency leads to impaired neural control of cardiac rhythmicity due in part to aberrant parasympathetic neurotransmission, making Kcna1 a strong candidate gene for human sudden unexplained death in epilepsy PMID: 20392939
  31. In Kcna1-null mice the absence of the Kv1.1 subunit results in a loss of temporal fidelity (increased jitter) and the failure to follow high-frequency amplitude-modulated sound stimulation in vivo PMID: 14534254
  32. Lack of Kv1.1 potassium channel subunits in CA3 pyramidal cells leads to synaptic hyperexcitability, as reflected in the propensity of these cells to generate multiple action potentials. PMID: 14636320
  33. Mceph/mceph mice carry a deletion in the gene encoding the Shaker-like voltage-gated potassium channel subtype 1, Kcna1. This causes a frame shift and the predicted MCEPH protein is truncated at amino acid 230, terminating with six aberrant amino acids. PMID: 14686897
  34. MCEPH protein is expressed in the brain of mceph/mceph mice. MCEPH was found to lack mature (Golgi) glycosylation, but to be core glycosylated and trapped in the endoplasmic reticulum (ER). Interactions between MCEPH and other Kv1 subunits PMID: 16305740
  35. Dendrotoxin-K(DTX-K) caused the largest increases, latency and jitter in Kcna1(-/-) cells and in 3 nM DTX-K-treated cells were similar to each other but increased compared with positive cells. PMID: 16672305
  36. Total absence of Kv1.1 can induce excessive overgrowth of hippocampus and ventral cortex in mice with a BALB/cByJ background, while mice with one wild type Kv1.1 allele develop normal-sized brains. PMID: 17250763
  37. Increasing membrane excitability by removing the Kcna1 gene, masked the absence epilepsy caused by a P/Q-type Ca(2+) channelopathy. PMID: 17982453
  38. The neural pathways encoding behaviorally relevant, rapid auditory temporal fluctuations are not limited by the absence of Kv1.1 expression. PMID: 18926893
  39. K(v)1.1 and K(v)1.2 were predominantly expressed in distinct EGC phenotypes. PMID: 19549557

Show More

Hide All

Database Links
Involvement In Disease
A spontaneous mutation leading to a frameshift and truncation of Kcna2 causes megencephaly with a 25% increase of brain weight relative to wild-type. Especially the hippocampus shows increased proliferation of neurons and astrocytes, leading to increased brain volume (PubMed:17315199). Mutant mice appear normal at birth. After 3-4 weeks, they display low body weight, a subtle shakiness in their gait, a preference for a strange sitting position that is maintained for periods ranging from 30 seconds to several minutes, excessive lacrimation and acoustic startle hypersensitivity (PubMed:8995755, PubMed:21966978). The increase in the acoustic startle response is down-regulated by treatment with the anti-epileptic drug valproate (PubMed:21966978). Mutant mice display an abnormal electro-encephalogram with single spikes and waves, when anesthesized (PubMed:21966978). The electric activity of mossy cells from the dentate hilus region is altered and shows increased firing of action potentials, probably due to the absence of functional Kcna1 channels (PubMed:14686897). Heterozygotes show mechanical allodynia, but no increased sensitivity to heat (PubMed:23473320). Homozygotes show no alteration of the islet of Langerhans structure, of the basal levels of insulin secretion and blood glucose levels (PubMed:21483673). Compared to wild-type, they display moderately increased insulin secretion in response to a glucose stimulus (PubMed:21483673). Besides, the frequency of beta cell action potentials is increased (PubMed:21483673).
Protein Families
Potassium channel family, A (Shaker) (TC 1.A.1.2) subfamily, Kv1.1/KCNA1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, axon. Membrane. Perikaryon. Cell projection, dendrite. Cell junction. Cell junction, synapse. Cytoplasmic vesicle. Endoplasmic reticulum. Cell junction, synapse, presynaptic cell membrane. Cell junction, synapse, presynapse.
Tissue Specificity
Detected in brain. Detected in the juxtaparanodal regions of the nodes of Ranvier in myelinated axons. Detected in the paranodal region in sciatic nerve. Detected on cell bodies in cerebellum, dorsal and ventral cochlear nucleus, pontine reticular nucleus

Q&A

What is the structural organization of Kcna1 in mice?

The mouse Kcna1 gene encodes the 495 amino acid Kv1.1 voltage-gated potassium channel α-subunit. Structurally, Kv1.1 contains six putative transmembrane segments (S1-S6), with the loop between S5 and S6 forming the pore region that contains the conserved selectivity filter motif (GYGD) . Functional Kv channels are comprised of four α-subunits which associate as homo- or hetero-tetramers to form a transmembrane pore. The complete channel complex also includes up to four accessory β-subunits that modulate channel gating, assembly, and trafficking .

How does native Kv1.1 distribution vary across different brain regions?

In the mammalian brain, Kv1.1 is not uniformly distributed. Immunohistochemical and biochemical analyses reveal that Kv1.1 levels are particularly low in the cerebellum and hippocampus, suggesting a low copy number in heterotetramer formations in these regions . This relatively low representation combined with Kv1.1's distinctive biophysical characteristics creates a low functional reserve in these structures, potentially explaining their vulnerability to Kv1.1 deficits. In most brain regions, Kv1.1 associates with Kv1.2 and/or Kv1.4 α-subunits to form heterotetramer channels, with evidence lacking for the presence of Kv1.1 homotetramers in the central nervous system .

What are the functional roles of Kv1.1 channels in neuronal physiology?

Kv1.1 channels play critical roles in regulating neuronal excitability by controlling action potential shape, repolarization, and firing properties . Compared to other members of the Kv1 family, Kv1.1 has a uniquely lower activation threshold and faster onset rate, making it specially suited for counterbalancing depolarizing inputs and preventing excessive neuronal excitation . Recent research has also revealed that Kv1.1 channels contribute to postnatal neurogenesis in the hippocampus, with Kcna1 knockout leading to altered proliferation of neural progenitor cells .

What phenotypes are observed in Kcna1 global knockout mice?

Kcna1-null mice exhibit several distinct phenotypes:

  • Seizures and mortality: Homozygous knockout mice begin experiencing spontaneous limbic seizures between two to three weeks of age, with only approximately 25% surviving to ten weeks depending on genetic background .

  • Sleep abnormalities: These mice display more fragmented sleep with reductions in REM and NREM sleep time .

  • Respiratory dysfunction: Abnormal respiration during non-seizure periods includes increased apnea frequency, elevated breathing rate, greater respiratory variability, and reduced sigh-apnea coupling and oxygen saturation levels .

  • Cardiac abnormalities: The knockout mice show increased frequency of atrioventricular conduction blocks and augmented heart rate variability. They also demonstrate susceptibility to inducible atrial fibrillation .

These multiple phenotypes highlight Kv1.1's importance in various physiological processes beyond simple neuronal excitability control.

How do conditional Kcna1 knockout models differ from global knockouts?

Neuron-specific conditional knockout (cKO) mice have been developed by crossing floxed Kcna1 mice with Synapsin1-Cre mice to specifically delete Kcna1 in neurons of the brain . These conditional knockouts recapitulate many phenotypes seen in global knockout animals, including epilepsy, cardiorespiratory abnormalities, and sudden death, suggesting neuronal Kv1.1 is largely responsible for these phenotypes .

What are the optimal methods for assessing Kv1.1 channel function in mouse models?

Multiple complementary approaches are recommended for comprehensive assessment of Kv1.1 channel function:

  • Electrophysiological recordings: Current-clamp recordings can reveal altered firing patterns in neurons from Kcna1-deficient mice. For example, in the medial nucleus of the trapezoid body, sustained depolarization triggers repetitive firing in Fmr1-/y mice rather than a single action potential as seen in wild-type animals . Voltage-clamp recordings can quantify specific K+ currents carried by Kv1.1 channels.

  • In vivo functional assessments: The auditory brainstem response (ABR) has been utilized to assess the functional consequences of altered Kv1.1 expression, revealing changes in both peripheral input (wave I) and central processing (wave IV) of auditory signals .

  • Immunohistochemistry: Using validated anti-KCNA1 antibodies (typically at 1:100 dilution) to visualize channel distribution in tissue sections . These can be combined with co-labeling of other neuronal markers to assess cell-type specific expression.

  • Biochemical techniques: Western blotting to quantify expression levels of Kv1.1 and potentially compensatory changes in related channel subunits .

  • Genetic labeling techniques: MADM (Mosaic Analysis with Double Markers) methodology can be employed to visualize and compare cells with different Kcna1 genotypes within the same animal .

How can researchers effectively deliver recombinant Kcna1 in gene transfer experiments?

For effective gene transfer of Kcna1, researchers have successfully employed HSV1 amplicon vector systems. The methodology involves:

  • Vector construction: Incorporation of the rat Kcna1 subunit gene and/or a reporter gene (such as E. coli lacZ) into an HSV1 amplicon vector .

  • Delivery method: Stereotaxic bilateral injection directly into the hippocampus of target mice .

  • Targeting considerations: This approach primarily results in infection of granule cells in the hippocampus, though the number of infected neurons has been reported to be variable across subjects .

  • Validation: Confirmation of "ectopic" Kv1.1 α channel subunit expression can be performed using Kcna1 immunocytochemistry .

  • Functional assessment: Electrophysiological recordings and behavioral testing can evaluate the functional impact of gene transfer.

Recent advances also include viral delivery specifically targeting astrocytes, which has been shown to rescue normal potassium uptake, neuronal excitability, and cognitive and social performance in certain disease models .

What techniques are available for studying Kcna1 expression during postnatal neurogenesis?

To investigate Kcna1's role in postnatal neurogenesis, researchers have employed innovative genetic lineage tracing approaches:

The Mosaic Analysis with Double Markers (MADM) system has been particularly valuable. In the MADM-6 system used with Kcna1:

  • Nestin-Cre mediated somatic recombination occurs in a subset of neural progenitor cells carrying MADM-6 cassettes.

  • Daughter cells bearing the Kcna1-/- alleles are labeled with green fluorescent protein (GFP), while wild-type sibling daughter cells are labeled with tdTomato (red).

  • This allows direct comparison of proliferation and differentiation between Kv1.1KO and wild-type cells within the same animal over time .

This technique revealed that a significantly larger number of green Kv1.1KO neurons were found in 2-3 month old Nestin-cre;Kcna1+/-;MADM-6 mice compared to red wild-type neurons, suggesting that Kv1.1 regulates proliferation of postnatal neural progenitor cells in mouse hippocampus .

What is the relationship between Kcna1 mutations and epilepsy phenotypes?

Analysis of 47 deleterious KCNA1 mutations has revealed important structure-function relationships relevant to epilepsy:

  • Mutation localization: Epilepsy or seizure-related variants tend to cluster in the S1/S2 transmembrane domains and in the pore region of Kv1.1, whereas episodic ataxia type 1 (EA1)-associated variants occur along the whole length of the protein .

  • Cellular mechanisms: At the cellular level, Kv1.1 is expressed in interneurons, including basket cells of the cerebellum. These cells form inhibitory synapses on Purkinje cells and provide the sole output from the cerebellar cortex. Kv1.1 dysfunction due to mutation is thought to cause hyperexcitability of these interneurons, leading to excessive inhibition of Purkinje cells and subsequent motor deficits .

  • Phenotypic variability: The same KCNA1 mutation can produce different phenotypes in different individuals, suggesting that genetic modifiers play an important role in determining disease manifestation and severity .

This structure-phenotype relationship helps explain why some patients have EA1 alone, while others have EA1 in combination with epilepsy or epilepsy alone.

How can Kv1.1 channel modulators be used as potential therapeutic agents?

Research has demonstrated that pharmacological modulation of Kv channels can potentially rescue neurophysiological phenotypes associated with channelopathies:

For example, AUT2 [((4-({5-[(4R)-4-ethyl-2,5-dioxo-1-imidazolidinyl]-2-pyridinyl}oxy)-2-(1-methylethyl) benzonitrile], a compound that modulates Kv3.1 channels, has shown promising results in a Fragile X syndrome model:

  • Mechanism of action: AUT2 reduced high-threshold K+ current and increased low-threshold K+ currents in neurons from Fmr1-/y animals by shifting the activation of the high-threshold current to more negative potentials .

  • Functional effects: This modulation reduced neuronal firing rate and restored wave IV of the auditory brainstem response (ABR) in vivo .

While this specific example involves Kv3.1 channels, it demonstrates the potential for similar approaches targeting Kv1.1 channels. The development of selective Kv1.1 channel modulators represents a promising therapeutic approach for treating disorders associated with Kcna1 dysfunction.

What is the potential of gene therapy approaches for treating Kcna1-related disorders?

Gene therapy shows promise for treating Kcna1-related disorders:

  • Viral vector delivery: HSV1 amplicon vectors containing the rat Kcna1 subunit gene have been successfully injected into hippocampal neurons, resulting in expression of the Kv1.1 α channel subunit .

  • Cell-specific targeting: Recent advances have demonstrated that viral delivery of Kir4.1 channels specifically to hippocampal astrocytes can rescue normal astrocyte potassium uptake, neuronal excitability, and cognitive and social performance in Fmr1 knockout mice . Similar approaches targeting neurons with Kcna1 could potentially be effective in treating disorders associated with Kv1.1 dysfunction.

  • Challenges: Variable infection rates across subjects have been observed, highlighting the need for improved delivery methods and expression consistency .

The development of more efficient and specific gene delivery systems, combined with a better understanding of the structure-function relationships of Kcna1 mutations, will be critical for advancing gene therapy approaches for treating these disorders.

How should researchers interpret contradictory findings between different Kcna1 animal models?

When interpreting contradictory findings between different Kcna1 animal models, researchers should consider:

  • Mutation type effects: The V408A mutation has a dominant negative effect that is more deleterious than complete absence of the gene, as evidenced by embryonic lethality in homozygous V408A mice compared to viability of global knockout mice beyond the embryonic stage .

  • Genetic background influences: The survival rate and phenotype severity of Kcna1-null mice depends on their genetic background, with only approximately 25% surviving to ten weeks in some strains .

  • Methodological differences: Variations in experimental approaches, including the timing and methods of assessment, can contribute to apparent contradictions between studies.

  • Tissue-specific effects: The neuron-specific conditional knockout recapitulates many but not all phenotypes of the global knockout, and with generally less severity, indicating important roles for Kv1.1 in non-neuronal tissues .

  • Compensatory mechanisms: The absence of compensatory changes in expression levels of related ion channel subunits in Kcna1 knockout mice suggests that altered physiology results directly from Kv1.1 loss rather than from secondary changes in channel expression.

What are the key challenges in developing valid in vitro systems for studying Kcna1 function?

Researchers face several challenges when developing in vitro systems to study Kcna1:

  • Heteromeric channel composition: In the brain, Kv1.1 naturally associates with Kv1.2 and/or Kv1.4 α-subunits to form heterotetramer channels, with little evidence for Kv1.1 homotetramers . Recreating these physiologically relevant channel compositions in vitro requires co-expression of multiple subunits.

  • Accessory subunit requirements: Complete channel complexes include up to four accessory β-subunits that impact channel gating, assembly, and trafficking , adding another layer of complexity to in vitro systems.

  • Cell type-specific effects: The functional impact of Kv1.1 varies between different neuronal populations, and cell culture models may not fully recapitulate the cellular environment of specific neuron types.

  • Regional expression variations: Kv1.1 levels vary across brain regions, with particularly low levels in the cerebellum and hippocampus , suggesting region-specific regulatory mechanisms that may be difficult to model in vitro.

  • Dynamic regulation: The expression and localization of Kv1.1 are dynamically regulated during development and in response to activity, presenting challenges for static in vitro systems.

What approaches can address the phenotypic variability observed in Kcna1-related disorders?

To address the significant phenotypic variability observed in Kcna1-related disorders, researchers should consider:

  • Mutation location analysis: Examination of mutation clustering can reveal important structure-function relationships, as evidenced by the observation that epilepsy/seizure-related variants tend to cluster in specific domains (S1/S2 and pore region), while EA1-associated variants occur throughout the protein .

  • Genetic modifier identification: Animal models demonstrate that genetic modifiers of KCNA1 mutations can significantly impact disease manifestation and severity . Whole genome or exome sequencing of patients with varying phenotypes but identical KCNA1 mutations could help identify these modifiers.

  • Comprehensive phenotyping: The entire cardiorespiratory system should be evaluated in patients with KCNA1 channelopathy, especially in cases involving epilepsy, as seizures in Kcna1-null mice evoke respiratory abnormalities that appear to drive cardiovascular dysfunction .

  • Multi-system assessment: Given Kv1.1's roles in multiple physiological systems, comprehensive assessment of patients should include evaluations of sleep, respiratory function, cardiac function, and other potential affected systems beyond the traditional neurological focus .

  • Development of new animal models: Generation of new animal models carrying clinically-relevant mutations will enhance understanding of genotype-phenotype relationships and potentially identify therapeutic targets .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.