Recombinant Mouse Potassium voltage-gated channel subfamily A member 2 (Kcna2)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Physiology and Disease

Kv1.2 channels regulate action potential repolarization in neurons and cardiomyocytes. Key findings from recent studies:

Neuronal Excitability and Motor Coordination

  • I402T Mutation (Pgu Mice): A missense mutation (Ile402Thr) in the S6 domain reduces functional Kv1.2 expression, increasing GABAergic inhibitory postsynaptic currents (IPSCs) in cerebellar Purkinje cells. This leads to chronic motor incoordination, mimicking human cerebellar ataxia .

  • Electrophysiological Defects: CHO cells expressing Kv1.2(I402T) show reduced current density despite minimal biophysical changes, suggesting impaired channel trafficking .

Cardiac Arrhythmias

  • Heart Failure Models: Downregulation of Kcna2 in rats correlates with reduced slow delayed rectifier potassium current (I<sub>Ks</sub>), prolonged action potentials (APs), and ventricular arrhythmias. Overexpression rescues I<sub>Ks</sub> and AP duration .

  • Kcna2 Antisense RNA: Upregulated in heart failure, this long noncoding RNA silences Kcna2, exacerbating arrhythmogenesis .

Epilepsy and Neurodevelopmental Disorders

  • Loss-of-Function Mutations: Associated with severe drug-resistant epilepsy due to neuronal hyperexcitability .

  • Gain-of-Function Mutations: Linked to developmental delay, ataxia, and cerebellar atrophy .

Experimental Uses

  • Electrophysiology: Patch-clamp studies in CHO cells or cerebellar slices to assess channel kinetics .

  • Disease Modeling: Transgenic mice (e.g., Pgu mutants) for studying ataxia and epilepsy mechanisms .

  • Drug Screening: Target for antiarrhythmic and neuroprotective compounds .

Therapeutic Potential

  • Gene Therapy: Transgenic complementation with wild-type Kcna2 partially rescues motor deficits in Pgu mice .

  • Pharmacological Rescue: Acetazolamide improves motor coordination in Kv1.2-deficient models .

Table 1: Kcna2 in Disease Models

ModelPhenotypeMechanismCitation
Pgu Mice (I402T)Chronic ataxia, ↑ GABAergic IPSCsReduced Kv1.2 trafficking
CHF RatsVentricular arrhythmias, ↓ I<sub>Ks</sub>Kcna2 antisense RNA silencing
Epilepsy PatientsDrug-resistant seizuresLoss-of-function mutations (e.g., P405L)

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time information.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development accordingly.
Synonyms
Kcna2; Potassium voltage-gated channel subfamily A member 2; MK2; Voltage-gated potassium channel subunit Kv1.2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-499
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Kcna2
Target Protein Sequence
MTVATGDPVDEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLG DPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGE EAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSF CLETLPIFRDENEDMHGGGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVR FFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVR VFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPS IPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE TEGEEQAQYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTA NCTLANTNYVNITKMLTDV
Uniprot No.

Target Background

Function
Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain and the central nervous system, but also in the cardiovascular system. Prevents aberrant action potential firing and regulates neuronal output. Forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane. Can form functional homotetrameric channels and heterotetrameric channels that contain variable proportions of KCNA1, KCNA2, KCNA4, KCNA5, KCNA6, KCNA7, and possibly other family members as well; channel properties depend on the type of alpha subunits that are part of the channel. Channel properties are modulated by cytoplasmic beta subunits that regulate the subcellular location of the alpha subunits and promote rapid inactivation of delayed rectifier potassium channels. In vivo, membranes probably contain a mixture of heteromeric potassium channel complexes, making it difficult to assign currents observed in intact tissues to any particular potassium channel family member. Homotetrameric KCNA2 forms a delayed-rectifier potassium channel that opens in response to membrane depolarization, followed by slow spontaneous channel closure. In contrast, a heteromultimer formed by KCNA2 and KCNA4 shows rapid inactivation. Contributes to the regulation of action potentials in neurons. KCNA2-containing channels play a presynaptic role and prevent hyperexcitability and aberrant action potential firing. Response to toxins that are selective for KCNA1, respectively for KCNA2, suggests that heteromeric potassium channels composed of both KCNA1 and KCNA2 play a role in pacemaking and regulate the output of deep cerebellar nuclear neurons. Response to toxins that are selective for KCNA2-containing potassium channels suggests that in Purkinje cells, dendritic subthreshold KCNA2-containing potassium channels prevent random spontaneous calcium spikes, suppressing dendritic hyperexcitability without hindering the generation of somatic action potentials, and thereby play an important role in motor coordination. KCNA2-containing channels play a role in GABAergic transmission from basket cells to Purkinje cells in the cerebellum, and thereby play an import role in motor coordination. Plays a role in the induction of long-term potentiation of neuron excitability in the CA3 layer of the hippocampus. May function as down-stream effector for G protein-coupled receptors and inhibit GABAergic inputs to basolateral amygdala neurons. May contribute to the regulation of neurotransmitter release, such as gamma-aminobutyric acid (GABA). Contributes to the regulation of the axonal release of the neurotransmitter dopamine. Reduced KCNA2 expression plays a role in the perception of neuropathic pain after peripheral nerve injury, but not acute pain. Plays a role in the regulation of the time spent in non-rapid eye movement (NREM) sleep.
Gene References Into Functions
  1. G9a contributes to neuropathic pain development through epigenetic silencing of Kcna2 in the axotomized dorsal root ganglion. PMID: 27874088
  2. Results indicate that MK2 activation induces MRTF-A phosphorylation at S351 and S371 upon stress. PMID: 27492266
  3. Kv1.2 mediates heterosynaptic modulation of direct cortical synaptic inputs in CA3 pyramidal cells. PMID: 26047212
  4. Analysis reveals fine-tuning of voltage sensitivity of the Kv1.2 potassium channel by interhelix loop dynamics. PMID: 23413033
  5. This study demonstrates that MK2 kinase is activated by TcdA and TcdB and regulates the expression of proinflammatory cytokines. PMID: 23264053
  6. Mk2 homozygous deletion in mice hinders the induction of experimental colitis by dextran sodium sulfate, supporting the notion that p38/Mk2 is involved in this inflammatory response. PMID: 23381627
  7. The dynamic Sig-1R-Kv1.2 complex represents a mechanism that shapes neuronal and behavioral response to cocaine. PMID: 23332758
  8. The findings suggest that Kv1.2 contributes to the regulation of nigrostriatal DA release by the D2-AR, offering a novel mechanism for the regulation of DA release. PMID: 21233214
  9. Data suggest that independent of known mutations in Kcna1 encoding Kv1.1, Kcna2 mutations may be significant molecular correlates underlying human cerebellar ataxic disease. PMID: 20696761
  10. Data demonstrate that PSD-95 colocalizes precisely with Kv1 potassium channels and Caspr2 at juxtaparanodes, and that a macromolecular complex of Kv1 channels and PSD-95 can be immunopurified from mammalian brain and spinal cord. PMID: 12438413
  11. Kcna2-null mice exhibit increased seizure susceptibility but, in contrast to Kcna1-null mice, hypoexcitability and enlarged Kv1 currents in auditory neurons. PMID: 17634333
  12. Kv1.2, a mammalian homologue of Shaker, regulates neuronal excitability and affects NREM sleep. PMID: 17925011
  13. A cluster of cytoplasmic C-terminal phosphorylation sites regulates Kv1.2 trafficking. PMID: 18056633
  14. K(v)1.1 and K(v)1.2 were predominantly expressed in distinct EGC phenotypes. K(v)1.2 was also observed in distinct neuron subpopulations. PMID: 19549557

Show More

Hide All

Database Links
Protein Families
Potassium channel family, A (Shaker) (TC 1.A.1.2) subfamily, Kv1.2/KCNA2 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane. Cell projection, axon. Cell junction, synapse. Endoplasmic reticulum membrane. Cell projection, lamellipodium membrane. Cell junction, synapse, synaptosome. Cell junction, synapse, presynaptic cell membrane. Cell projection, dendrite. Perikaryon. Cell junction, paranodal septate junction.
Tissue Specificity
Detected in brain. Detected in cerebellum. Detected in mitral cells in the olfactory bulb. Detected in cochlea. Detected in cerebellum, particularly in the basket cell axon plexus and in the terminal regions around Purkinje cells. Detected in juxtaparanod

Q&A

What is the basic function of KCNA2 in neuronal systems?

KCNA2 encodes the voltage-gated potassium channel Kv1.2, which mediates transmembrane potassium transport in excitable membranes, primarily in the brain and central nervous system, but also in the cardiovascular system. It plays a critical role in preventing aberrant action potential firing and regulating neuronal output. KCNA2 forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient, alternating between opened and closed conformations in response to voltage differences across the membrane . In neurons, KCNA2-containing channels regulate action potentials and prevent hyperexcitability, contributing significantly to neuronal signaling precision .

How do KCNA2 channels assemble in native tissues?

KCNA2 can form both homotetrameric channels (composed of four identical Kv1.2 subunits) and heterotetrameric channels containing variable proportions of KCNA1, KCNA2, KCNA4, KCNA5, KCNA6, KCNA7, and possibly other family members. Channel properties depend on the specific alpha subunits comprising the channel . In vivo, membranes likely contain a mixture of heteromeric potassium channel complexes, making it difficult to assign currents observed in intact tissues to any particular potassium channel family member. Channel properties are further modulated by cytoplasmic beta subunits that regulate subcellular localization of alpha subunits and promote rapid inactivation of delayed rectifier potassium channels . For experimental studies, it's essential to consider that artificially expressed homomeric channels may behave differently than native heteromeric complexes.

What are the key structural domains that affect KCNA2 function?

KCNA2 contains several critical structural domains that determine its function:

  • Voltage-sensing domain (VSD) - Contains the S4 helix with positively charged residues that respond to membrane potential changes.

  • Pore domain - Formed by the S5-S6 segments and determines ion selectivity and conductance.

  • PVP motif - The proline(405)-valine(406)-proline(407) sequence in transmembrane domain S6 serves as a critical gating hinge .

  • N- and C-terminal domains - Less conserved regions involved in protein-protein interactions and channel modulation.

Pathogenic variants are significantly enriched in the voltage sensing domain (S4), the pore-loop (S5-S6), and the ion conducting pore with the gating mechanism (S5 and S6) , highlighting these regions' functional importance.

What expression systems are optimal for recombinant mouse KCNA2 production?

Several expression systems have been successfully used for recombinant KCNA2 production, each with specific advantages:

Expression SystemAdvantagesPurity RangeApplicationsReference
HEK-293 CellsNative-like post-translational modifications, high expression level>80-90%Electrophysiology, structural studies
Cell-free Protein Synthesis (CFPS)Rapid production, avoid toxicity issues>70-80%Preliminary studies, high-throughput screening
CHO CellsGood for functional studiesNot specifiedElectrophysiological characterization

When selecting an expression system, consider the specific experimental requirements. For biophysical and functional studies requiring properly folded and post-translationally modified channels, mammalian systems like HEK-293 cells are preferred. For structural studies requiring high purity, affinity tags (His, Strep, or Myc-DYKDDDDK) can facilitate purification . Verification of proper expression should include techniques such as Western blotting, SDS-PAGE, analytical SEC (HPLC), and functional assays .

How can I assess KCNA2 trafficking and membrane localization?

To evaluate KCNA2 trafficking and membrane localization, several complementary approaches can be employed:

  • Immunofluorescence microscopy: Use specific antibodies against KCNA2 or epitope tags to visualize subcellular localization. Co-staining with plasma membrane markers helps confirm surface expression.

  • Surface biotinylation assay: Label surface proteins with membrane-impermeable biotin reagents, followed by streptavidin pull-down and Western blotting to quantify membrane-expressed KCNA2.

  • Electrophysiological recordings: Whole-cell patch clamp recordings provide functional evidence of channel expression at the membrane. Even mutations that don't affect trafficking may alter functional properties, as seen with the F302L variant that reaches the membrane but exhibits altered gating .

  • Fluorescent protein fusions: N- or C-terminal fusion of GFP or other fluorescent proteins allows real-time visualization of trafficking in live cells.

When investigating mutations, comparing wild-type and mutant trafficking patterns is crucial. For example, the F302L mutation doesn't affect membrane trafficking but significantly alters channel function , indicating that normal trafficking doesn't guarantee normal function.

What are reliable methods for functional characterization of recombinant KCNA2 channels?

Several established methods provide comprehensive functional characterization of KCNA2 channels:

  • Patch-clamp electrophysiology: The gold standard for functional characterization, providing direct measurement of channel currents. Both conventional and automated patch-clamp systems can be used to assess:

    • Voltage-dependent activation and inactivation

    • Deactivation kinetics

    • Single-channel conductance

    • Response to pharmacological agents

  • Voltage-sensitive optical methods: These techniques allow tracking of conformational changes in the voltage-sensing domain:

    • Voltage-clamp fluorometry can track voltage sensor movements by attaching environmentally sensitive fluorophores to the extracellular portions of the voltage sensor .

    • These approaches revealed that mutations like F302L enhance voltage sensor function, contributing to both gain- and loss-of-function effects .

  • Molecular dynamics simulations: Computational approaches that can predict how mutations alter channel exposure to membrane lipids and protein conformational dynamics .

  • Heterologous co-expression studies: Co-expressing wild-type and mutant subunits can assess dominant-negative effects and determine if mutations can be rescued by wild-type subunits .

For accurate functional assessment, it's essential to conduct experiments at physiological temperature with proper ionic conditions that mimic the in vivo environment.

KCNA2 Mutations and Disease Models

Several mouse models have provided valuable insights into KCNA2-related disorders:

  • Knock-out models: KCNA2 knock-out mice exhibit hyperexcitability and an epileptic phenotype, demonstrating the channel's essential role in maintaining neuronal excitability balance .

  • Point mutation models: The "Pingu" (Pgu) mouse carries an I402T missense mutation in the S6 segment of KCNA2 and exhibits chronic motor incoordination. Electrophysiological studies revealed increased frequency and amplitude of spontaneous GABAergic inhibitory postsynaptic currents and reduced action potential firing frequency in Purkinje cells .

  • Rescue approaches: Both pharmacological treatment with acetazolamide and transgenic complementation with wild-type KCNA2 cDNA partially rescued motor incoordination in Pgu mice, suggesting potential therapeutic approaches .

These models have revealed mechanisms underlying neurological symptoms. In Pgu mice, immunochemical analyses showed reduced expression of Kv1 channels in basket cell terminals, and cellular studies demonstrated that the I402T mutation causes subtle changes in biophysical properties but dramatically decreases the amount of functional Kv1 channels . This suggests that even minor alterations in channel properties can significantly impact neuronal circuit function.

What methodological approaches can detect pathogenic KCNA2 variants?

Multiple complementary methods are used to identify and classify KCNA2 variants:

  • Genetic screening:

    • Whole exome sequencing (WES) has been crucial in identifying de novo mutations in patients with epileptic encephalopathy .

    • Targeted gene panels for epilepsy and neurological disorders can identify KCNA2 variants more cost-effectively.

    • Multiplex amplicon quantification techniques can detect copy number variations affecting KCNA2 .

  • Variant classification:

    • Pathogenicity prediction tools like REVEL (combining 13 individual pathogenicity scores) show high performance in discriminating pathogenic from benign variants .

    • Additional established prediction tools include CADD, M-CAP, PolyPhen, and SIFT .

    • Population databases like gnomAD help identify putatively benign variants, which cluster at less conserved N- and C-termini .

  • Functional validation:

    • Electrophysiological characterization in heterologous expression systems

    • Trafficking studies using fluorescence microscopy

    • Computational modeling to predict structural and functional consequences

When analyzing novel variants, researchers should consider their location relative to known functional domains and established pathogenic mutations. Variants in the voltage sensing domain (S4), pore-loop (S5-S6), and ion conducting pore (S5 and S6) are more likely to be pathogenic .

How can molecular dynamics simulations enhance understanding of KCNA2 function?

Molecular dynamics (MD) simulations provide unique insights into KCNA2 structure-function relationships that are difficult to obtain experimentally:

  • Lipid-protein interactions: MD simulations have revealed how mutations can alter VSD exposure to membrane lipids, affecting voltage sensing and gating properties. For example, the F302L mutation changes how the voltage-sensing domain interacts with the lipid environment .

  • Conformational transitions: Simulations can capture the dynamic conformational changes during channel activation, inactivation, and recovery, helping researchers understand how specific residues contribute to these processes.

  • Ion permeation mechanisms: MD simulations elucidate how potassium ions interact with the selectivity filter and how mutations might disrupt this process.

  • Prediction of mutation effects: By simulating the structural consequences of amino acid substitutions, researchers can predict functional outcomes before performing time-consuming experimental validations.

For meaningful MD simulations, researchers should use:

  • High-resolution structural templates (ideally based on Kv1.2 crystal structures)

  • Appropriate lipid bilayer compositions that mimic neuronal membranes

  • Sufficient simulation time to capture relevant conformational changes

  • Proper force fields optimized for membrane proteins

The insights gained from MD simulations complement experimental data and can guide the design of targeted functional studies to understand mechanisms of channelopathy.

What strategies can determine if KCNA2 variants cause gain- or loss-of-function?

Distinguishing between gain-of-function (GoF) and loss-of-function (LoF) effects is crucial for understanding pathogenic mechanisms and developing targeted therapies. A comprehensive approach includes:

  • Detailed electrophysiological characterization:

    • Voltage-dependent activation and inactivation curves

    • Kinetics of activation, deactivation, and inactivation

    • Recovery from inactivation

    • Single-channel properties (open probability, conductance)

  • Combined expression studies:

    • Homomeric expression (wild-type or mutant alone)

    • Heteromeric expression (wild-type and mutant together to assess dominant effects)

    • Expression with other KCNA family members to mimic native complexes

  • Specific parameters to evaluate:

    • For GoF: Look for hyperpolarized activation threshold, increased current amplitude, slowed inactivation

    • For LoF: Look for reduced current amplitude, accelerated inactivation, impaired trafficking

    • For mixed effects: Some mutations show complex patterns, such as F302L which causes GoF via accelerated channel opening at more hyperpolarized potentials but also LoF via accelerated inactivation onset

  • Correlation with clinical phenotypes:

    • GoF mutations typically cause more severe epileptic encephalopathy

    • LoF mutations often associate with milder epilepsy, episodic ataxia

    • Mixed GoF/LoF variants frequently show earlier developmental abnormalities and earlier epilepsy onset

This multifaceted approach helps clarify how different mutations lead to distinct clinical presentations and guides rational therapeutic development.

What are the methodological considerations for studying KCNA2 in neuronal circuits?

Investigating KCNA2 function in native neuronal circuits requires specialized approaches:

  • Neuronal expression systems:

    • Primary neuronal cultures preserve native signaling pathways and protein interactions

    • Brain slice preparations maintain intact circuitry

    • In vivo models allow assessment of behavioral consequences

  • Cell-type specific approaches:

    • KCNA2 is expressed in multiple neuronal types with different functional consequences

    • In cerebellar circuits, KCNA2 is abundant in basket cell terminals that form axo-somatic synapses onto Purkinje cells

    • Cell-type specific manipulations using Cre-Lox systems or viral vectors with cell-type specific promoters

  • Circuit-level analysis techniques:

    • Multi-electrode arrays to record network activity

    • Calcium imaging to monitor population dynamics

    • Optogenetic manipulation combined with electrophysiology

    • Paired recordings to assess synaptic transmission

  • Relevant functional readouts:

    • Spontaneous GABAergic inhibitory postsynaptic currents (IPSCs) in Purkinje cells show increased frequency and amplitude in KCNA2 mutant mice

    • Action potential firing frequency in Purkinje cells is reduced in KCNA2 mutants

    • Excitatory/inhibitory balance assessment is critical as KCNA2 mutations can enhance synaptic release preferentially in excitatory neurons

Understanding KCNA2 in neuronal circuits provides insights into how channel dysfunction leads to neurological symptoms and identifies potential therapeutic targets.

How should researchers interpret contradictory functional data from different KCNA2 expression systems?

When faced with contradictory results across expression systems, consider these methodological approaches:

  • Systematic comparison of expression systems:

    • Different cell backgrounds provide different membrane compositions and auxiliary proteins

    • HEK-293 cells may yield different results than CHO cells or neurons due to different protein processing machinery

    • Create a comparative table documenting all parameters across systems

  • Evaluate technical factors:

    • Recording conditions (temperature, solutions, voltage protocols)

    • Expression levels (excessive overexpression can lead to artifacts)

    • Presence/absence of auxiliary subunits

    • Post-translational modifications in different systems

  • Resolution strategies:

    • Use multiple independent approaches to verify findings

    • Include positive and negative controls

    • Test in neurons or native tissues when possible

    • Consider effects of heteromeric assembly with other KCNA family members

  • Interpretation framework:

    • Focus on consistent phenotypes across systems

    • Acknowledge system-specific differences

    • Consider physiological relevance of each system

    • Perform dose-response experiments with varying expression levels

When publishing, transparently report all experimental conditions and acknowledge limitations of each system to aid reproducibility and interpretation.

What quality control measures ensure reliable recombinant KCNA2 studies?

To ensure high-quality, reproducible KCNA2 research, implement these quality control measures:

  • Protein expression and purity verification:

    • Assess purity using SDS-PAGE, Western Blot, and analytical SEC (HPLC)

    • Confirm identity using mass spectrometry or anti-tag ELISA

    • Verify proper folding using circular dichroism or functional assays

  • Functional validation controls:

    • Include wild-type channels as positive controls

    • Use known dysfunctional mutants as negative controls

    • Test channel blockers (e.g., 4-aminopyridine) to confirm specific currents

    • Perform non-transfected cell controls

  • Experimental design considerations:

    • Blind analysis where possible

    • Include technical and biological replicates

    • Randomize experimental order

    • Use multiple independent transfections/preparations

  • Data quality metrics:

    • Signal-to-noise ratio for electrophysiology recordings

    • Stable baseline currents before pharmacological interventions

    • Consistent reversal potentials for potassium currents

    • Access resistance stability during patch-clamp recordings

Implementing these measures will minimize artifacts and increase confidence in experimental outcomes, particularly when studying subtle functional changes in mutant channels.

How can researchers best translate KCNA2 functional findings to clinical applications?

Bridging the gap between basic KCNA2 research and clinical applications requires an integrated translational approach:

  • Genotype-phenotype correlation studies:

    • Systematically catalog mutations and their functional effects

    • Correlate with clinical phenotypes from patient cohorts

    • Create a classification system based on functional consequences

    • Consider genetic background effects that may modify phenotypes

  • Therapeutic strategy development based on channel dysfunction:

    • For GoF mutations: Consider channel blockers or negative modulators

    • For LoF mutations: Explore channel openers or methods to enhance expression

    • For trafficking defects: Investigate molecular chaperones or modified temperature

    • Exemplified by successful partial rescue of motor incoordination in Pgu mice using acetazolamide

  • Translational validation in multiple models:

    • Human iPSC-derived neurons from patients

    • Animal models with equivalent mutations

    • Ex vivo brain slice preparations

    • In silico modeling of circuit-level effects

  • Considerations for precision medicine:

    • Mutations with mixed effects may require combination therapies

    • Development of mutation-specific approaches

    • Patient stratification based on functional characterization

    • Biomarker development for treatment response prediction

This translational pipeline can accelerate development of therapies for KCNA2-related disorders while advancing understanding of fundamental channel biology in neurological function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.