Recombinant Mouse Potassium voltage-gated channel subfamily A member 3 (Kcna3)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant Kcna3 is produced using heterologous expression systems:

  • Host Systems: E. coli, yeast, baculovirus, or mammalian cells .

  • Purification: Affinity chromatography (via His tag) followed by SDS-PAGE validation (>90% purity) .

  • Storage: Lyophilized in Tris/PBS buffer with 6% trehalose; stable at -80°C .

Table 2: Production Parameters

ParameterSpecification
Expression HostE. coli (commonly used for high yield)
TagN-terminal His tag
Purity≥85% (SDS-PAGE) , >90% (commercial preparations)
Reconstitution0.1–1.0 mg/mL in sterile water with 50% glycerol for stability

Functional and Mechanistic Insights

Kv1.3 channels are pivotal in T-cell activation and autoimmune responses. Research highlights include:

  • Immune Regulation: Kv1.3 mediates K⁺ efflux during T-cell receptor signaling, enabling calcium influx and cytokine production (e.g., IL-2) .

  • Epigenetic Control: CRBN (cereblon) suppresses Kcna3 transcription via histone modification (H3K27me3), modulating T-cell hyperactivity .

  • Pathophysiological Roles:

    • Knockout (Kcna3⁻/⁻) rats show compensatory upregulation of KCa3.1 channels, preserving T-cell function .

    • Dysregulation linked to autoimmune diseases (e.g., multiple sclerosis) and neurotoxicity .

Research Applications

Recombinant Kcna3 is utilized in:

  • Drug Development: High-throughput screening for Kv1.3 inhibitors (e.g., ShK-Dap22) to treat autoimmune disorders .

  • Structural Studies: Cryo-EM and X-ray crystallography to resolve channel architecture .

  • Functional Assays: Electrophysiology (patch-clamp) and calcium flux measurements in immune cells .

Clinical and Therapeutic Relevance

  • Autoimmunity: Kv1.3 blockers reduce T-cell-mediated inflammation in experimental autoimmune encephalomyelitis (EAE) .

  • Neurological Disorders: KCNA3 mutations are associated with developmental epileptic encephalopathy and autism spectrum disorder .

Challenges and Future Directions

  • Compensatory Mechanisms: KCa3.1 upregulation in Kcna3⁻/⁻ models complicates therapeutic targeting .

  • Structural Dynamics: Resolving ligand-binding sites for selective inhibitor design .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributors for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Typically, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
Kcna3; Potassium voltage-gated channel subfamily A member 3; MK3; Voltage-gated potassium channel subunit Kv1.3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-528
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MTVVPGDHLLEPEAAGGGGGDPPQGGCGSGGGGGGCDRYEPLPPALPAAGEQDCCGERVV INISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGG RIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYP ESSGPARGIAIVSVLVILISIVIFCLETLPEFRDEKDYPASPSQDVFEAANNSTSGAPSG ASSFSDPFFVVETLCIIWFSFELLVRFFACPSKATFSRNIMNLIDIVAIIPYFITLGTEL AERQGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFI GVILFSSAVYFAEADDPSSGFNSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIA GVLTIALPVPVIVSNFNYFYHRETEGEEQAQYMHVGSCQHLSSSAEELRKARSNSTLSKS EYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV
Uniprot No.

Target Background

Function
This protein regulates the voltage-dependent potassium ion permeability of excitable membranes. It transitions between open and closed conformations in response to the voltage difference across the membrane, forming a potassium-selective channel that allows potassium ions to pass according to their electrochemical gradient.
Gene References Into Functions
  1. Our findings elucidate the potential role of Kv1.3 in weight gain and insulin-dependent responses, contributing to our understanding of adipocyte physiology. PMID: 29947924
  2. Data indicate that cereblon (CRBN) regulates CD4(+) T-cell activation through epigenetic control of Kv1.3 potassium channel expression. PMID: 27439875
  3. Following differentiation with LPS or a combination of LPS and IFN-gamma, microglia displayed significant Kv 1.3 current densities (approximately 50 pA/pF at 40 mV) and minimal KCa 3.1 and Kir currents. Conversely, microglia differentiated with IL-4 exhibited substantial Kir 2.1 currents (approximately 10 pA/pF at -120 mV). KCa 3.1 currents were generally low. PMID: 27696527
  4. These studies reveal unexpected roles for Kv1.3 subunit-containing channels in regulating firing patterns of striatal cholinergic interneurons, which were previously thought to be primarily dependent on KCa channels. PMID: 27568555
  5. The tertiary structure of the C-terminal domain of Kv1.3 is essential and sufficient for Kv1.3- KCNE4 interaction. PMID: 27802162
  6. This protein promotes B lymphocyte activation, proliferation, and monocyte chemotaxis. PMID: 26795234
  7. Alterations in Kv1.3 subcellular distribution upon EGFR activation were attributed to Kv1.3 clathrin-dependent endocytosis, which targets the Kv1.3 channels to the lysosomal degradative pathway. PMID: 26542799
  8. The Kv1.3 channel functions as a negative regulator of phagocytosis in macrophages and holds potential as a therapeutic target for addressing macrophage dysfunction. PMID: 26354506
  9. Our findings suggest that Kv1.3 may stimulate macrophage migration through the activation of ERK. PMID: 26748289
  10. A compensatory upregulation of the potassium channels K2P3.1 and KV1.3 appears to offset the deletion of K2P5.1. PMID: 26213925
  11. Antigenic Stimulation of Kv1.3-Deficient Th Cells Generates a Population of Foxp3-Independent T Cells with Suppressive Properties. PMID: 26150529
  12. A potent and selective peptide blocker of the Kv1.3 channel: prediction from free-energy simulations and experimental validation. PMID: 24244345
  13. Our research indicates that Kv1.3 plays a unique role in neuronal differentiation and/or survival of interneuron populations in the cerebral cortex. PMID: 23821603
  14. Inhibition of NMDAR antagonists on the conductivity of Kv1.3 and KCa3.1 potassium channels was observed. PMID: 24344200
  15. A notable increase in Kv1.3 protein levels was observed following LPS challenge, an effect that was mitigated by e-LXA4. Kv1.3 is essential for the attenuation of NF-kappaB activity. PMID: 24249731
  16. Results suggest the potential use of Kv1.3 blockers for treating obesity and insulin resistance. PMID: 23729813
  17. This protein exerts inhibitory effects on thymocyte Kv1.3-channel currents. PMID: 22978806
  18. Data indicate that ShK-K amide retained a high affinity for the voltage-gated potassium channel Kv1.3 channels (IC50 26 +/- 3 pM). PMID: 23063513
  19. Findings suggest that pathways activated in Kv1.3-/- that increased energy expenditure and led to resistance to DIO are olfactory bulb dependent. PMID: 22435906
  20. Our data demonstrate that Kv1.3 plays a significant role in Ag-specific activation of CD4+ T cells during the course of experimental autoimmune encephalomyelitis. PMID: 22581856
  21. The conserved upregulation of Kv1.3 on phenotypic modulation in several vascular beds makes this channel a promising target for controlling unwanted vascular remodeling. PMID: 22383699
  22. Mitral cells of the olfactory bulb perform metabolic sensing and are disrupted by obesity at the level of the Kv1.3 ion channel. PMID: 21966386
  23. KCNE2 influences blood-CSF anion flux by regulating KCNQ1 and KCNA3 in the choroid plexus epithelium. PMID: 21859894
  24. Findings are not supportive of a role for Kv1.3 in modulating peripheral insulin sensitivity. PMID: 21586699
  25. Kv1.3/TASK2 channels appear to be primarily responsible for regulatory volume decrease in murine T-lymphocytes. PMID: 21575593
  26. K(V)1.3 potassium channels are functional in proliferating mouse and human vascular smooth muscle cells and exert positive effects on cell migration. Blockers of these channels may be useful as inhibitors of neointimal hyperplasia. PMID: 20884640
  27. The presence of a tonotopic gradient in presynaptic terminals suggests that Kv1.3 may differentially regulate neurotransmitter release in neurons that respond to different sound frequencies. PMID: 20575068
  28. This study demonstrated that the olfactory phenotype of Kv1.3-/- animals is partly due to an enhancement of K(Na) currents. PMID: 20393063
  29. We conclude that Kv1.3 constitutes the Kv channel of the platelet and megakaryocyte, which establishes the resting membrane potential. PMID: 20308249
  30. Kv1.3 currents increased in proliferating vascular smooth muscle cells, and their selective blockade inhibits migration and proliferation. PMID: 20299686
  31. Results indicate that Kv1.3 containing channels predominantly determined Kdr currents in activated microglia after status epilepticus. PMID: 19707551
  32. The level of chloride current in Kv1.3-/- thymocytes was increased approximately 50-fold compared to wild-type cells. PMID: 12878608
  33. Macrophage cells expressed outward delayed and inwardly rectifying K+ currents primarily mediated by Kv1.3 and Kir2.1 channels. PMID: 12923194
  34. These data suggest that Kv1.3 plays a broader role in signal transduction, development, and olfactory coding beyond its classically defined function as a potassium channel – to shape excitability by influencing membrane potential. PMID: 14766178
  35. Kv1.3 gene deletion and channel inhibition enhance peripheral insulin sensitivity in vivo and affect insulin-stimulated glucose uptake. PMID: 14981264
  36. Kv1.3 and Kir2.1 expression was compromised in the brain during cancer cachexia. PMID: 15304346
  37. Results indicate that the increase in insulin sensitivity observed with Kv1.3 channel inhibition is mediated by an increase in GLUT4 protein at the plasma membrane, largely through a Ca(2+)-dependent process. PMID: 16403947
  38. Kv1.5 co-associates with Kv1.3, forming functional heterotetramers in macrophages. PMID: 17038323
  39. Kv1.3-based treatments to modify physiological responses, such as proliferation and activation, are impaired by Kv1.5 expression. PMID: 17157812
  40. Deletion of the voltage-gated channel( kv1.3) impacts glomerular refinement and odorant receptor expression in the mouse olfactory system. PMID: 18022950
  41. These findings implicate the trafficking and localization of Kv1.3/Kv1.5 heteromers in the complex regulation of immune system cells. PMID: 18218624
  42. Gene-targeted deletion of Kv1.3 can reduce adiposity and total body weight in a genetic model of obesity by increasing both locomotor activity and mass-specific metabolism. PMID: 18542083
  43. This study reports co-localization of adaptor proteins nShc & Grb10, with the Kv1.3 channel in the olfactory bulb neural lamina; BDNF-induced current suppression of the Kv1.3 channel was prevented by both nShc and Grb10. PMID: 19166614
  44. Segregation of Kv1.3 channels into the immunological synapse modifies the gating properties of the channels. PMID: 19477198

Show More

Hide All

Database Links
Protein Families
Potassium channel family, A (Shaker) (TC 1.A.1.2) subfamily, Kv1.3/KCNA3 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Kcna3 gene and what protein does it encode?

The Kcna3 gene encodes the voltage-gated potassium channel Kv1.3, which belongs to the Shaker family of Kv1 channels. Kv1.3 is a voltage-gated pore-forming K+ channel α-subunit that functions as a tetrameric structure to form a functional ion channel . The channel is activated by membrane depolarization and allows potassium efflux, which helps maintain the electrochemical gradient across cell membranes. This is crucial for various cellular functions, particularly in immune cells where it sustains the driving force for calcium entry needed for activation and proliferation . The protein contains transmembrane regions flanked by N- and C-terminal intracellular domains, with the pore domain consisting of the S5-S6 transmembrane segments and the linker between them, which allows K+ flux across the membrane .

What is the primary cellular distribution of Kv1.3 channels?

Kv1.3 channels are predominantly expressed in immune-related cells but are not limited to them. The channel was originally identified in non-excitable cells, particularly T lymphocytes, where it plays a crucial role in activation and function . Beyond T cells, Kv1.3 is highly expressed in various immune cells including macrophages, neutrophils, and microglia . Importantly, contrary to earlier assumptions that Kv1.3 was restricted to immune cells, recent research has demonstrated its expression in neurons within epileptogenic brain regions such as the hippocampus . This broader expression pattern explains why mutations in this primarily immune-related channel can also cause neurological disorders like developmental and epileptic encephalopathy (DEE) .

How does Kv1.3 contribute to T-cell activation?

Kv1.3 channels play a critical role in T-cell activation through several mechanisms:

  • Membrane potential regulation: Kv1.3 channels prevent membrane depolarization by allowing K+ efflux, which is essential for maintaining the electrochemical gradient .

  • Calcium signaling facilitation: By maintaining the membrane potential, Kv1.3 sustains the large driving force necessary for calcium entry during T-cell activation . This calcium influx is crucial for downstream signaling events leading to T-cell proliferation and cytokine production.

  • Regulated expression: In resting T cells, the expression of Kv1.3 is regulated by CRBN (cereblon), which normally represses Kv1.3 expression through epigenetic modifications of the Kcna3 gene locus . CRBN binds directly to conserved DNA elements adjacent to the Kcna3 gene via a specific DNA-binding motif and controls the recruitment of EZH1 to regulate histone modifications .

  • Activation consequences: When CRBN is absent, Kv1.3 expression increases, leading to enhanced potassium flux, which in turn triggers increased calcium flux during T-cell activation . This results in T-cell hyperactivation and increased IL-2 production upon T-cell receptor stimulation .

Why are rats preferred over mice for studying Kv1.3 function in T cells?

Rats are often preferred over mice for studying Kv1.3 function in T cells due to critical species-specific differences in potassium channel expression patterns:

  • Expression redundancy in mice: Mice express multiple Kv1 family members in T cells, rendering Kv1.3 functionally redundant . This redundancy precludes the translation of mouse T-cell function findings to humans .

  • Human-like expression in rats: Rats' T cells phenotypically resemble human T cells regarding Kv1.3 expression. Specifically, Kv1.3 is the only Kv1 member expressed by rat T cells, similar to humans .

  • Experimental validation: Electrophysiological studies confirm that rat models more accurately represent human Kv1.3 dependency in T cells . This similarity makes rat models more translatable to human conditions.

In research examining the specific contributions of Kv1.3 to T-cell function, Kcna3 knockout rats provide a more relevant model than mice because the absence of redundant potassium channels allows researchers to directly observe the consequences of Kv1.3 deficiency .

How are Kcna3 knockout models generated and validated?

Generation and validation of Kcna3 knockout models involve several technical steps:

Generation:

  • For rats, zinc finger nuclease-targeted deletion has been successfully used to generate Kcna3-deficient animals on Dark Agouti rat backgrounds .

  • The knockout strategy typically involves targeting specific regions of the Kcna3 gene to create a non-functional gene product.

Validation methods:

  • mRNA expression analysis: RT-PCR or RNA sequencing to confirm the absence of Kcna3 transcripts in knockout animals .

  • Protein detection: Flow cytometry to validate the absence of Kv1.3 protein expression .

  • Functional confirmation: Electrophysiology to verify the absence of Kv1.3-dependent currents in isolated T cells .

  • Compensatory expression assessment: Evaluation of other potassium channel expression (especially KCa3.1/Kcnn4) to identify potential compensatory mechanisms .

The comprehensive validation process ensures that the knockout model specifically eliminates Kv1.3 function without causing broader developmental abnormalities that could confound experimental results. For example, validated Kcna3 knockout rats appear phenotypically normal with no gross abnormalities, and detailed characterization of their immune compartment reveals no differences in T- or B-cell populations compared to wild-type rats .

What electrophysiological techniques are most effective for studying Kv1.3 channel function?

Effective electrophysiological techniques for studying Kv1.3 channel function include:

In published studies, electrophysiological confirmation has been crucial for validating Kcna3 knockout models, demonstrating that Kv1.3-dependent currents become undetectable in T cells isolated from these animals .

How is Kcna3/Kv1.3 expression epigenetically regulated?

Kcna3/Kv1.3 expression is subject to sophisticated epigenetic regulation, primarily through the following mechanisms:

  • CRBN-mediated repression: Cereblon (CRBN) acts as an important antagonist of Kv1.3 expression in resting T cells . CRBN forms an E3 ubiquitin ligase complex with damaged DNA-binding protein 1 (DDB1) and Cul4A, which is involved in regulating gene expression .

  • Direct DNA binding: CRBN binds directly to conserved DNA elements adjacent to the Kcna3 gene through a previously uncharacterized DNA-binding motif . This binding is sequence-specific and regulates transcriptional access to the Kcna3 locus.

  • Histone modification control: CRBN controls the recruitment of EZH1 (Enhancer of Zeste Homolog 1) to the Kcna3 gene region . EZH1 is part of the Polycomb Repressive Complex, which mediates histone methylation, specifically H3K27 trimethylation, a repressive mark that reduces gene expression.

  • Derepression mechanism: In the absence of CRBN, as demonstrated in Crbn-deficient mice, this epigenetic repression is lifted. The result is increased expression of Kv1.3, leading to enhanced potassium flux and T-cell hyperactivation .

This epigenetic regulation represents an important mechanism for controlling T-cell activation thresholds and preventing inappropriate immune responses. The discovery of this regulatory pathway has significant implications for understanding immune disorders and potential therapeutic interventions targeting Kv1.3 expression.

What is the relationship between Kv1.3 and KCa3.1 channels in T-cell function?

The relationship between Kv1.3 and KCa3.1 potassium channels in T-cell function is characterized by functional cooperation and compensatory mechanisms:

  • Complementary roles: Both Kv1.3 (voltage-gated) and KCa3.1 (calcium-activated) potassium channels contribute to T-cell activation by maintaining the electrochemical gradient necessary for calcium influx, but they respond to different signals .

  • Compensatory expression: Research with Kcna3 knockout rats demonstrates that KCa3.1 expression increases significantly in the absence of Kv1.3, showing a three- to six-fold upregulation in T cells from Kcna3-deficient rats after antigen exposure compared to wild-type controls . This compensatory upregulation explains why Kcna3-deficient T cells remain functionally competent.

  • Redundant mechanisms: The compensatory relationship provides redundant mechanisms to ensure T-cell activation can proceed even when one channel type is compromised . This is evidenced by the observation that Kcna3-deficient rats can still mount normal T-cell responses despite lacking Kv1.3.

  • Differential utilization based on activation history: The relative dependency on Kv1.3 versus KCa3.1 changes with repeated antigen exposure . Specifically:

    • In wild-type rats, Kcna3 transcript levels increase approximately five-fold after three rounds of repeated antigen stimulation

    • Concurrently, Kcnn4 (encoding KCa3.1) levels decrease by nearly 70% with repeated antigen stimulation

    • In Kcna3-deficient rats, KCa3.1 expression continues to increase with each immunization

This dynamic relationship suggests that therapeutic strategies targeting either channel alone may have limited efficacy, as T cells can adapt by relying more heavily on the alternative channel type.

How does repeated antigen exposure affect Kv1.3 channel expression and function?

Repeated antigen exposure significantly alters Kv1.3 channel expression and function in T cells through several mechanisms:

  • Upregulation of Kv1.3 expression: In wild-type animals, multiple exposures to the same antigen progressively increase Kcna3 transcript levels. Research shows approximately a five-fold increase in Kcna3 expression after three rounds of repeated antigen stimulation compared to initial exposure .

  • Concurrent downregulation of KCa3.1: As Kv1.3 expression increases with repeated antigen exposure, there is a corresponding decrease in Kcnn4 (encoding KCa3.1) expression, with levels decreasing by nearly 70% after three rounds of stimulation .

  • Shift in channel dependency: This reciprocal regulation indicates a progressive shift in potassium channel dependency from KCa3.1 towards Kv1.3 with repeated antigen encounters . This shift may represent a form of functional adaptation in repeatedly activated T cells.

  • Memory phenotype correlation: The channel expression shift correlates with changes in CCR7 expression, which is reduced following multiple rounds of immunization, indicating an increase in effector memory T cells (TEM) relative to central memory T cells (TCM) .

These findings have important implications for understanding chronic inflammatory and autoimmune conditions where T cells encounter the same antigens repeatedly. The progressive shift toward Kv1.3 dependency with repeated antigen exposure suggests that Kv1.3-specific blockers may be particularly effective in targeting chronically activated T cells involved in autoimmune pathology, while having less impact on newly activated T cells responding to novel antigens.

What role does Kv1.3 play in autoimmune and inflammatory conditions?

Kv1.3 plays a significant role in autoimmune and inflammatory conditions through several mechanisms:

  • T-cell hyperactivation: In the absence of normal Kv1.3 regulation, as observed in CRBN-deficient mice, CD4+ T cells show increased activation and IL-2 production upon T-cell receptor stimulation, ultimately resulting in enhanced potassium flux and calcium-mediated signaling . This hyperactivation can contribute to inflammatory pathology.

  • Experimental autoimmune encephalomyelitis exacerbation: Research demonstrates that experimental autoimmune encephalomyelitis (a model for multiple sclerosis) is exacerbated in T-cell-specific CRBN-deficient mice due to increased T-cell activation via Kv1.3 .

  • Therapeutic target: Due to its critical role in mediating immune responses, Kv1.3 represents an important therapeutic target for immunosuppression in neuroinflammatory diseases such as multiple sclerosis and Alzheimer's disease .

  • Selective expression in chronically activated T cells: With repeated antigen exposure, T cells progressively shift toward greater Kv1.3 dependency . This makes Kv1.3 a particularly relevant target in chronic inflammatory conditions where T cells encounter the same antigens repeatedly.

  • Microglial activation: Beyond T cells, Kv1.3 is also expressed in microglia and contributes to their inflammatory activation . Activated microglia are implicated in various neurodegenerative and neuroinflammatory conditions.

The central role of Kv1.3 in immune cell activation makes it a promising target for developing selective immunomodulatory therapies that might have fewer side effects than broader immunosuppressive approaches.

What is the evidence linking KCNA3 mutations to neurological disorders?

Recent research has established compelling evidence linking KCNA3 mutations to neurological disorders, particularly developmental and epileptic encephalopathy (DEE):

  • Identification of pathogenic variants: A comprehensive study screening exome and genome sequence data from parent-offspring trios linked to developmental disorders discovered 14 individuals with 13 different heterozygous de novo missense mutations in KCNA3 .

  • Phenotypic characterization: Detailed phenotypic assessment revealed that approximately two-thirds of these individuals had early-onset epilepsy with seizures beginning in infancy . Seizure types varied widely, including tonic, tonic-clonic, clonic, myoclonic, atonic, and absence seizures. Most were drug-resistant, and one person died at 3 years of age after status epilepticus .

  • Developmental impairments: All individuals with epilepsy were classified as having DEE due to concomitant developmental impairments, including global developmental delay, delayed speech, and intellectual disability .

  • Mutation hotspots: Among the 13 de novo Kv1.3 variants identified, 9 mapped to critical functional regions - specifically the S6 transmembrane segment or S5-S6 linker of the pore domain that allows K+ flux across the membrane . These pore domain-associated variants were highly associated with epilepsy, with all 5 located in S6 exhibiting DEE .

  • Critical structural elements: One DEE-associated variant in S6 (P477H) affected the second proline of the highly conserved proline-valine-proline (PVP) motif crucial for forming the pore activation gate . Missense mutations affecting the corresponding amino acid in related channels (Kv1.1 and Kv1.2) also cause DEE, reinforcing the association between the PVP motif in Kv1 channels and severe epilepsy .

This evidence establishes KCNA3 as an important gene in the etiology of DEE, expanding our understanding of the genetic basis of epilepsy and highlighting the importance of Kv1.3 in neuronal function.

How do loss-of-function versus gain-of-function mutations in KCNA3 affect phenotype?

Loss-of-function (LoF) versus gain-of-function (GoF) mutations in KCNA3 lead to distinct phenotypic consequences:

Loss-of-function mutations:

  • Neurological effects: LoF mutations in KCNA3, particularly those affecting the pore domain, are predominantly associated with developmental and epileptic encephalopathy (DEE) . These mutations impair the channel's ability to conduct potassium ions.

  • Molecular mechanism: When Kv1.3 function is reduced in neurons, this can lead to membrane hyperexcitability due to impaired repolarization, potentially causing seizure-inducing hyperactivity in epileptogenic brain regions like the hippocampus .

  • Treatment implications: For LoF-related epilepsy, Kv1.3 channel activators would theoretically be the most promising therapeutic approach, though such compounds are still in development .

Gain-of-function mutations:

  • Immune system effects: In immune cells, enhanced Kv1.3 function (as seen with loss of CRBN-mediated repression) leads to T-cell hyperactivation, increased cytokine production, and potentially exacerbated autoimmune responses .

  • Therapeutic targeting: For conditions involving GoF mutations or overexpression, Kv1.3 blockers represent a viable therapeutic strategy. Several natural venom peptides (like ShK) block Kv1.3 with high potency and specificity, though most cannot cross the blood-brain barrier .

  • Brain-penetrant inhibitors: For neuroinflammatory conditions involving excessive Kv1.3 activity, small molecules like PAP-1 that inhibit Kv1.3 with high specificity, cross the blood-brain barrier, and have demonstrated preclinical efficacy in treating neuroinflammation represent promising therapeutic options .

The distinct consequences of LoF versus GoF mutations highlight the complex role of Kv1.3 in different tissues and the need for targeted therapeutic approaches based on the specific molecular pathology.

What are the most effective pharmacological tools for studying Kv1.3 function?

Several pharmacological tools have proven effective for studying Kv1.3 function, each with specific advantages:

Peptide toxins:

  • ShK toxin: Derived from the sea anemone Stichodactyla helianthus, ShK blocks Kv1.3 with high potency (Kd = 10 pM) . It's commonly used at concentrations around 10 nM for in vitro studies . While highly specific, it may have some activity against closely related channels at higher concentrations.

  • Margatoxin: Another peptide toxin with high selectivity for Kv1.3 that has been useful for distinguishing Kv1.3 currents from other potassium currents.

Small molecules:

  • PAP-1: A small-molecule inhibitor that blocks Kv1.3 with high specificity. Unlike peptide toxins, PAP-1 can cross the blood-brain barrier, making it valuable for studying Kv1.3 function in the CNS . It has demonstrated preclinical efficacy for treating neuroinflammation in neurodegenerative disease models .

KCa3.1 inhibitors (for comparative studies):

  • TRAM-34: A selective blocker of KCa3.1 channels with a Kd of approximately 20 nM . Often used in combination with Kv1.3 blockers to dissect the relative contributions of these channels to cellular functions.

Experimental considerations:

  • When using channel blockers, it's important to consider the potential for compensatory mechanisms. For example, studies show that even when treating cells with both ShK and TRAM-34 at concentrations well above their Kd values, Kcna3-deficient T cells can still mount substantial responses, suggesting additional compensatory mechanisms beyond these two channels .

  • For comprehensive analysis, combining pharmacological approaches with genetic models (Kcna3 knockout) and electrophysiological techniques provides the most robust insights into Kv1.3 function.

What techniques are best for measuring Kv1.3-dependent immune cell activation?

Measuring Kv1.3-dependent immune cell activation requires a multi-faceted approach combining several complementary techniques:

  • Proliferation assays: These assess T-cell proliferative responses following antigen stimulation, which can be measured in the presence or absence of Kv1.3 blockers to determine channel dependency . Common methods include:

    • 3H-thymidine incorporation

    • CFSE dilution monitored by flow cytometry

    • Cell counting and viability assays

  • Cytokine production measurement: Quantification of cytokines like IL-2 and IFN-γ production following T-cell receptor stimulation provides functional readouts of T-cell activation . Methods include:

    • ELISA for cytokine detection in culture supernatants

    • Intracellular cytokine staining and flow cytometry

    • Cytokine mRNA quantification by RT-PCR

  • Calcium flux measurement: Since Kv1.3 function affects calcium signaling, measuring intracellular calcium changes using fluorescent calcium indicators (e.g., Fura-2, Fluo-4) provides insights into the immediate consequences of Kv1.3 activity .

  • Antigen recall assays: In vivo immunization followed by in vitro restimulation with antigen allows assessment of antigen-specific T-cell responses . This approach is particularly valuable for examining how Kv1.3 contributes to physiologically relevant immune responses.

  • Electrophysiological recordings: Direct measurement of potassium currents through patch-clamp techniques provides definitive evidence of Kv1.3 activity .

  • Gene and protein expression analysis: Quantification of Kcna3 and Kcnn4 transcript levels by RT-PCR or RNA sequencing, along with protein detection by flow cytometry or Western blotting, helps correlate channel expression with functional outcomes .

Combining these techniques in both wild-type systems with pharmacological blockers and genetic models (e.g., Kcna3 knockout animals) provides comprehensive insights into how Kv1.3 contributes to immune cell activation under various conditions.

How can researchers effectively design experiments to study the interplay between Kv1.3 and KCa3.1 channels?

Effectively studying the interplay between Kv1.3 and KCa3.1 channels requires careful experimental design:

1. Combined genetic and pharmacological approaches:

  • Use Kcna3 knockout models (preferably rats rather than mice) to eliminate Kv1.3 function

  • Apply selective channel blockers (ShK for Kv1.3, TRAM-34 for KCa3.1) individually and in combination

  • Compare results between genetic deletion and pharmacological blockade to identify potential compensatory mechanisms

2. Antigen exposure paradigms:

  • Implement protocols with varying numbers of antigen exposures (e.g., single vs. repeated immunization)

  • Consider using two different antigens with different exposure schedules to compare channel dependency

  • For example, one antigen administered three times and a second antigen given once alongside the first antigen in the final immunization

3. Comprehensive readouts:

  • Measure channel expression at both mRNA level (Kcna3 for Kv1.3, Kcnn4 for KCa3.1) and protein level

  • Assess T-cell activation markers (e.g., CD69, CD25)

  • Quantify functional outcomes including proliferation and cytokine production

  • Evaluate calcium signaling as an intermediate readout

4. Memory phenotype characterization:

  • Include measurements of memory markers such as CCR7 to correlate channel dependency with T-cell differentiation state

  • Compare naive, central memory, and effector memory T-cell populations

5. Time-course experiments:

  • Examine channel expression and function at multiple time points after antigen exposure

  • Consider both acute responses and long-term adaptation

6. Translational validation:

  • Include comparative studies with human T cells to verify the relevance of findings across species

  • Consider examining pathogen-specific versus autoreactive T cells to explore potential differences in channel dependency

This comprehensive approach allows researchers to dissect the complementary and compensatory roles of Kv1.3 and KCa3.1, providing insights into how these channels cooperate to ensure T-cell activation under various conditions. Such studies are essential for developing targeted immunomodulatory therapies that account for the dynamic interplay between these channels.

What are the most promising therapeutic applications targeting Kv1.3 channels?

The most promising therapeutic applications targeting Kv1.3 channels span both immunological and neurological disorders:

  • Autoimmune disease treatment: Given Kv1.3's critical role in T-cell activation, selective Kv1.3 blockers represent promising immunomodulatory agents for conditions like multiple sclerosis, rheumatoid arthritis, and psoriasis . This approach may be particularly effective for targeting chronically activated effector memory T cells that become increasingly Kv1.3-dependent with repeated antigen exposure .

  • Neuroinflammation in neurodegenerative diseases: Kv1.3 inhibitors, particularly those that can cross the blood-brain barrier like PAP-1, show potential for treating neuroinflammatory components of conditions such as Alzheimer's disease . These compounds can target not only infiltrating T cells but also activated microglia that express Kv1.3 .

  • Epilepsy treatment: For epilepsy caused by loss-of-function KCNA3 mutations, development of Kv1.3 channel activators represents a promising therapeutic strategy . While such compounds are still in development, they offer a mechanistically targeted approach to treating KCNA3-related developmental and epileptic encephalopathy.

  • Combination therapies: Understanding the compensatory relationship between Kv1.3 and KCa3.1 suggests that combination therapies targeting both channels may be necessary for complete immunomodulation in some contexts . This approach could overcome the redundancy that allows T cells to remain functional despite blockade of a single channel type.

The therapeutic potential of Kv1.3-targeting approaches is enhanced by the increasing understanding of how channel expression and function vary across cell types, activation states, and disease contexts. This knowledge allows for more precise targeting of pathological processes while potentially minimizing effects on normal immune and neuronal function.

What are the current limitations in Kcna3/Kv1.3 research and future directions?

Current limitations in Kcna3/Kv1.3 research and promising future directions include:

Current limitations:

  • Model system challenges: Mice are suboptimal models for studying Kv1.3 function in T cells due to redundant expression of multiple Kv1 family members . While rats provide better translational value, differences between rodent and human immune systems still exist.

  • Compensatory mechanisms: The significant compensation by KCa3.1 and potentially other ion channels in Kcna3-deficient models complicates interpretation of knockout phenotypes . This redundancy can mask the full importance of Kv1.3 in normal physiology.

  • Blood-brain barrier penetration: Many high-specificity Kv1.3 blockers, particularly peptide toxins, cannot cross the blood-brain barrier, limiting their utility for targeting CNS Kv1.3 channels .

  • Complexity of immune cell subsets: Different immune cell subsets show varying dependence on Kv1.3, and how these differences impact disease processes remains incompletely understood .

Future directions:

  • Development of context-specific modulators: Creating compounds that selectively activate or inhibit Kv1.3 in specific cell types or tissues would advance both research capabilities and therapeutic precision .

  • Human immunology studies: Expanding research to include more extensive studies of Kv1.3 function in human immune cells from both healthy donors and patients with autoimmune diseases.

  • Single-cell approaches: Implementing single-cell transcriptomics and functional studies to better understand the heterogeneity of Kv1.3 expression and function across immune cell subpopulations.

  • Structural biology advances: Determining high-resolution structures of Kv1.3 in different conformational states to facilitate rational drug design of both inhibitors and activators .

  • Long-term in vivo studies: Conducting extended studies to evaluate the consequences of chronic Kv1.3 modulation, particularly regarding potential compensatory mechanisms that might emerge during prolonged treatment.

  • Clinical translation: Moving promising Kv1.3-targeting compounds into clinical trials for both autoimmune conditions and KCNA3-related epilepsy, with careful biomarker development to identify patients most likely to benefit from these targeted approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.