Recombinant Mouse Potassium voltage-gated channel subfamily A member 4 (Kcna4)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Overview

Kcna4 (Gene ID: 16517) encodes the α-subunit of the Kv1.4 voltage-gated potassium channel, characterized by six transmembrane domains (S1–S6) and a cytoplasmic N-terminal inactivation domain . Key features include:

PropertyDetails
Chromosomal LocationMouse chromosome 3 (syntenic to human 11p14.1)
Protein AliasesKv1.4, RCK4, Type A potassium channel
Structural MotifsShaker-type repeat in S4 segment; tandem N-terminal inactivation domains
Molecular Weight~70–75 kDa (calculated for full-length recombinant protein)

Functional Role in Cardiac Physiology

Kcna4 regulates the cardiac transient outward potassium current (I<sub>to,s</sub>), influencing action potential repolarization . Key findings:

  • Nup50 Interaction: Nucleoporin 50 (Nup50) binds the Kcna4 promoter, increasing mRNA and protein expression by ~4-fold in cardiomyocytes .

  • Current Density: Overexpression of Nup50 elevates Kv1.4-mediated current density to 22.37 pA/pF at +70 mV vs. 12.62 pA/pF in controls .

Table 2: Nup50-Mediated Regulation of Kcna4

ParameterNup50 OverexpressionNup50 Knockdown
Kcna4 mRNA Levels↑ 300–400%↓ 50–60%
Kv1.4 Protein Expression↑ 2.5-fold↓ 40–50%
I<sub>to,s</sub> CurrentEnhanced inactivationReduced amplitude

Research Applications

Recombinant mouse Kcna4 is utilized in:

  • Electrophysiology: Characterizing inactivation kinetics (τ ≈ 50–100 ms at +40 mV) .

  • Antibody Development: Anti-Kv1.4 antibodies (e.g., Clone L71/5R) validated for WB/IHC .

  • Disease Modeling: Studying epilepsy and arrhythmias linked to Kv1.4 dysfunction .

Validation and Quality Control

Commercial recombinant Kcna4 is validated via:

  • SDS-PAGE/Western Blot: Single band at ~70 kDa .

  • Functional Assays: Whole-cell patch clamp confirming voltage-dependent activation (V<sub>1/2</sub> ≈ −30 mV) .

  • Immunoprecipitation: Interaction with DLG1/DLG4 scaffolding proteins .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Kcna4; Potassium voltage-gated channel subfamily A member 4; Voltage-gated potassium channel subunit Kv1.4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-654
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Kcna4
Target Protein Sequence
MEVAMVSAESSGCNSHMPYGYAAQARARERERLAHSRAAAAAAVAAATAAVEGTGGSGGG PHHHHQTRGAYSSHDPQGSRGSRRRRRQRTEKKKLHHRQSSFPHCSDLMPSGSEEKILRE LSEEEEDEEEEEEEEEEGRFYYSEEDHGDGCSYTDLLPQDDGGGGGYSSVRYSDCCERVV INVSGLRFETQMKTLAQFPETLLGDPEKRTQYFDPLRNEYFFDRNRPSFDAILYYYQSGG RLKRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEEDRALPENEFKKQIWLLFEY PESSSPARGIAIVSVLVILISIVIFCLETLPEFRDDRDLIMALSAGGHSRLLNDTSAPHL ENSGHTIFNDPFFIVETVCIVWFSFEFVVRCFACPSQALFFKNIMNIIDIVSILPYFITL GTDLAQQQGGGNGQQQQAMSFAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELG LLIFFLFIGVILFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTVGYGDMKPITVGGKI VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRS STSSSLGDKSEYLEMEEGVKESLCGKEEKCQGKGDESETDKNNCSNAKAVETDV
Uniprot No.

Target Background

Function
Voltage-gated potassium channel mediating transmembrane potassium transport in excitable membranes. It forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel transitions between open and closed conformations in response to the voltage difference across the membrane. It can form functional homotetrameric channels and heterotetrameric channels composed of varying proportions of KCNA1, KCNA2, KCNA4, KCNA5, and potentially other family members. The channel properties are influenced by the specific alpha subunits present in the channel. Channel properties are further modulated by cytoplasmic beta subunits that regulate the subcellular location of alpha subunits and promote rapid inactivation. In vivo, membranes likely contain a mixture of heteromeric potassium channel complexes, making it challenging to assign currents observed in intact tissues to any particular potassium channel family member. Homotetrameric KCNA4 forms a potassium channel that opens in response to membrane depolarization, followed by rapid spontaneous channel closure. Similarly, a heterotetrameric channel formed by KCNA1 and KCNA4 exhibits rapid inactivation.
Gene References Into Functions
  1. Data indicates that suprachiasmatic nucleus (SCN) explants from potassium channel Kv1.4(-/-)period2 protein Per2(Luc) and potassium channel Kv4.2(-/-) period2 protein Per2(Luc) mice exhibit significantly shorter circadian periods in PER2 rhythms. PMID: 26152125
  2. Increased A-type K(+) currents and expression of voltage-gated potassium channel Kcna4 (Kv1.4) are observed in SNS-gp130(-/-) nociceptors. PMID: 24463703
  3. Experimental evidence demonstrates that Kv4.2, Kv4.3, and Kv1.4 all contribute to the formation of potassium channels in mature cortical pyramidal (CP) neurons; these channels play distinct roles in regulating the intrinsic properties of mature CP neurons. PMID: 22615428
  4. Kv1.4- and Kv4.2-encoded I(A) channels regulate the intrinsic excitability of SCN neurons during the day and night, influencing the period and amplitude of circadian rhythms in SCN neuron firing and locomotor behavior. PMID: 22815518
  5. This study demonstrates that Kcna4 gene expression occurs in the mouse dorsal raphe nucleus. PMID: 22534482
  6. Targeted deletion of the Kv1.4 alpha-subunit (along with Kv4.2 and Kv4.3) demonstrates that individual alpha-subunits encode for the I(A) current in cortical pyramidal neurons. PMID: 20371829
  7. PSD-95 increases the amount of Kv1.4, but not Kv4.2, in lipid rafts. PMID: 14559911
  8. Data suggests that Kv1.4 expression is regulated through a complex interplay of distinct RNA regions. PMID: 15339906
  9. Pituitary adenylate cyclase activating polypeptide reduces kv1.4 expression in the olfactory bulb. PMID: 16426762
  10. In experimental autoimmune encephalomyelitis, Kv1.4 immunoreactivity is detected in or around lesions during disease onset, peaking early and subsequently decreasing in the late phase of the disease. PMID: 17600124

Show More

Hide All

Database Links
Protein Families
Potassium channel family, A (Shaker) (TC 1.A.1.2) subfamily, Kv1.4/KCNA4 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, axon.
Tissue Specificity
Expressed in the brain, lens and retina.

Q&A

What is the molecular identity and genomic location of mouse Kcna4?

Mouse Kcna4 (Kv1.4) belongs to the Kv1 (Shaker) subfamily of voltage-gated potassium channels. According to molecular characterization studies, the gene encoding Kcna4 is located on mouse chromosome 2, while the human ortholog KCNA4 is positioned on chromosome 11p14 . Like other K+ channel α subunits, Kcna4 is a transmembrane protein that assembles as a tetramer to form a functional K+ selective pore . The protein contains six transmembrane segments with a voltage-sensing domain and a pore-forming region characteristic of voltage-gated potassium channels.

What is the primary functional role of Kcna4 in cardiac tissue?

Kcna4 encodes the slow transient outward potassium current (I(to,s)) in mouse cardiac tissue . This current plays a significant role in action potential repolarization, although its importance varies across species. In mice, I(to,s) contributes to repolarization, but electrophysiological data indicate that its role is less prominent than I(to,f) (fast transient outward current), which is encoded by Kv4.2 and Kv4.3 channels . Studies with knockout models have demonstrated that action potential repolarization remains relatively fast even in animals lacking both I(to,f) and I(to,s) , suggesting the involvement of additional potassium currents in mouse cardiac repolarization.

How can Kcna4 be distinguished from other Kv1 family members?

Kcna4 has distinct functional and structural characteristics that differentiate it from other Kv1 family members:

PropertyKcna4 (Kv1.4)Other Kv1 Family Members (e.g., Kv1.5)
InactivationRapid N-type inactivationTypically slower inactivation
Current typeI(to,s) (slow transient outward)I(K,slow)/I(Kur) (for Kv1.5)
Recovery from inactivationSlowTypically faster
Assembly behaviorDoes not coassemble with Kv1.5 in myocardiumVarious heteromeric possibilities

Research has definitively shown that "Kv1.4 and Kv1.5 encode distinct populations of voltage-gated cardiac K+ channels, I(to,s) and I(K,slow) (I(Kur)) (Table 1), and that the Kv1.4 and Kv1.5 proteins do not coassemble in the (mouse) myocardium" .

What expression systems are optimal for studying recombinant mouse Kcna4?

For functional expression of recombinant mouse Kcna4, researchers typically employ several heterologous expression systems:

  • Mammalian cell lines: HEK293 cells provide appropriate post-translational processing for mammalian potassium channels.

  • Xenopus oocytes: Offer robust expression suitable for detailed electrophysiological characterization.

  • Cardiomyocyte culture systems: Provide the most physiologically relevant environment for studying cardiac ion channel function.

What electrophysiological protocols best characterize Kcna4 currents?

To properly characterize Kcna4-mediated I(to,s) currents, the following electrophysiological approaches are recommended:

  • Voltage-clamp protocols:

    • Holding potential: -80 to -100 mV

    • Depolarizing steps: -40 to +60 mV in 10 mV increments

    • Duration: 300-500 ms to capture full inactivation profile

  • Current isolation techniques:

    • Pharmacological approach: Use specific blockers of other K+ currents

    • Genetic approach: Compare currents in wild-type versus Kv1.4−/− cardiac myocytes

  • Recovery from inactivation:

    • Two-pulse protocol with variable interpulse intervals to characterize the slow recovery kinetics distinctive of I(to,s)

Electrophysiological studies have been crucial in defining the roles of specific K+ channels in cardiac function , allowing researchers to distinguish Kcna4-mediated currents from other potassium currents based on their unique biophysical properties.

What strategies are effective for generating Kcna4 knockout or transgenic mouse models?

Based on existing K+ channel mouse models described in the literature, several strategies can be employed:

  • Gene deletion approaches:

    • Complete deletion of the Kcna4 coding sequence

    • Targeted deletion of specific exons (similar to approaches used for KCNQ1 where either exon 1 or exon 2 was deleted)

    • Replacement with reporter genes (as done with KCNE1 replaced by LacZ)

  • Dominant-negative approaches:

    • Expression of non-functional Kcna4 mutants that can suppress endogenous channel function

    • Similar to the Kv4.2W362F dominant-negative approach used to study I(to,f)

  • Tissue-specific manipulation:

    • Cardiac-specific promoters for targeted expression or deletion

    • Inducible systems to control timing of gene manipulation

How do regional differences in Kcna4 expression contribute to cardiac electrophysiological heterogeneity?

Cardiac K+ channels exhibit differential distribution across the heart, "contributing to regional differences in action potential waveforms, transmitter-mediated responses, and the impact of myocardial damage and/or disease" . For Kcna4 specifically, researchers should investigate:

  • Chamber-specific expression patterns:

    • Comparative expression in atria versus ventricles

    • Transmural gradients (epicardium, midmyocardium, endocardium)

    • Base-to-apex differences

  • Functional impact assessment:

    • Region-specific action potential recordings

    • Correlation of Kcna4 expression with action potential duration

    • Contribution to dispersion of repolarization

  • Methodological approaches:

    • Quantitative PCR with tissue microdissection

    • Immunohistochemistry with region-specific quantification

    • Laser capture microdissection followed by expression analysis

    • Optical mapping of repolarization patterns in Kv1.4−/− hearts

Understanding these regional differences is essential for interpreting the complex electrophysiological phenotypes observed in genetic models and disease states.

How do post-translational modifications regulate Kcna4 channel function?

While the search results don't specifically address post-translational modifications of Kcna4, voltage-gated potassium channels are known to be extensively regulated by such modifications. Research approaches should include:

  • Phosphorylation analysis:

    • Identification of phosphorylation sites using mass spectrometry

    • Functional consequences using phosphomimetic and phosphoresistant mutations

    • Regulatory kinases and phosphatases in cardiac tissue

  • Other modifications:

    • Glycosylation sites and their impact on trafficking

    • Ubiquitination and channel turnover rates

    • Palmitoylation and membrane microdomain localization

  • Physiological regulation:

    • Response to autonomic stimulation

    • Effects of pathological conditions (ischemia, heart failure)

K+ channels are "targets for the actions of neurotransmitters, neurohormones, intracellular mediators, and exogenous drugs that modulate cardiac function" , and understanding the molecular basis of this regulation is critical for comprehensive characterization of Kcna4 function.

What are the compensatory mechanisms in Kcna4-deficient cardiac tissue?

When studying Kv1.4−/− models, researchers should investigate potential compensatory changes:

  • Altered expression of other K+ channels:

    • Changes in Kv4.2/Kv4.3 (I(to,f))

    • Upregulation of I(K,slow) components

    • Changes in I(ss) or I(K1)

  • Functional adaptation:

    • Altered kinetics of remaining K+ currents

    • Changes in other ionic currents (Ca2+, Na+)

    • Modifications in channel trafficking or membrane localization

  • Methodological approaches:

    • Comprehensive transcriptional profiling

    • Quantitative proteomics

    • Detailed electrophysiological characterization of all major cardiac currents

These analyses are important because research has shown that "action potential repolarization remains fast in animals lacking I(to,f), as well as in animals in which both I(to,f) and I(to,s) are eliminated" , suggesting significant compensatory mechanisms.

What cardiac phenotypes are associated with Kcna4 dysfunction in mouse models?

While the search results don't provide explicit details on Kv1.4−/− cardiac phenotypes, by extrapolation from other K+ channel models, researchers should examine:

  • Electrocardiographic parameters:

    • QT interval duration and rate adaptation

    • P wave and PR interval characteristics

    • ST-T wave morphology

  • Arrhythmia susceptibility:

    • Spontaneous arrhythmias

    • Response to programmed electrical stimulation

    • Susceptibility to pharmacological provocation

  • Cellular electrophysiology:

    • Action potential duration and morphology

    • Early and delayed afterdepolarizations

    • Conduction properties and heterogeneity

The consequences may be subtle compared to other K+ channel deficiencies, as "the extent of action potential and QT prolongation in animals lacking I(to,f) is greater than when either component of I(K,slow) is eliminated" .

How does Kcna4 contribute to inherited cardiac arrhythmia syndromes?

To investigate the role of Kcna4 in inherited arrhythmias, researchers should:

  • Genetic screening approach:

    • Sequence KCNA4 in patients with unexplained arrhythmias

    • Analyze genetic variants for functional consequences

    • Correlate genotype with phenotype in family studies

  • Functional characterization of variants:

    • Expression of mutant channels in heterologous systems

    • Detailed biophysical characterization

    • Computer modeling of impact on action potential

  • Animal modeling:

    • Generate knock-in models of human disease-associated variants

    • Detailed phenotyping for arrhythmia susceptibility

    • Response to antiarrhythmic interventions

While the search results don't specifically link Kcna4 to inherited arrhythmias, the general principle that "the properties and/or expression of these K+ channels are altered with myocardial disease, changes that affect the propagation of electrical activity and increase the propensity to develop and sustain arrhythmias" suggests the importance of investigating such connections.

What pharmacological approaches can specifically target Kcna4 for research applications?

For selective modulation of Kcna4 channels in research settings:

  • Channel blockers:

    • 4-aminopyridine at specific concentrations

    • Selective Kv1.4 inhibitors (where available)

    • Peptide toxins with Kv1.4 selectivity

  • Modifiers of channel kinetics:

    • Compounds affecting inactivation rates

    • Modulators of recovery from inactivation

    • Drugs that shift voltage-dependence of activation/inactivation

  • Experimental design considerations:

    • Concentration-response relationships

    • Specificity testing against other cardiac K+ channels

    • Off-target effects assessment

These pharmacological tools are essential for isolating and characterizing Kcna4 currents in complex cardiac preparations and for validating the phenotypes observed in genetic models.

What emerging technologies will advance Kcna4 research?

Future Kcna4 research will benefit from cutting-edge methodologies:

  • CRISPR/Cas9 gene editing:

    • Precise modification of Kcna4 at the endogenous locus

    • Introduction of human disease-associated variants

    • High-throughput screening of regulatory elements

  • Single-cell technologies:

    • Single-cell RNA-seq to reveal cell-specific expression patterns

    • Patch-seq for correlating electrophysiology with transcriptomics

    • Super-resolution imaging of channel localization

  • In silico approaches:

    • Molecular dynamics simulations of channel gating

    • Systems biology models of cardiac electrophysiology

    • AI-driven prediction of drug-channel interactions

These approaches will help address remaining questions about Kcna4 function and regulation in cardiac physiology and pathophysiology.

How can Kcna4 research inform therapeutic strategies for cardiac arrhythmias?

Translational research on Kcna4 may contribute to arrhythmia management through:

  • Precision medicine approaches:

    • Targeting therapy based on patient-specific channel expression/function

    • Genotype-guided antiarrhythmic selection

    • Development of selective Kcna4 modulators

  • Gene therapy strategies:

    • Correction of dysfunctional channel expression

    • Targeted delivery to specific cardiac regions

    • Inducible expression systems

  • Biomarker development:

    • Kcna4 expression/function as a predictor of arrhythmia risk

    • Channel-specific responses to antiarrhythmic therapy

    • Non-invasive assessment of repolarization abnormalities

These approaches recognize the potential of K+ channels as therapeutic targets, building on the understanding that they "control resting potentials, action potential waveforms, automaticity, and refractory periods" in cardiac tissue.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.