Recombinant Mouse Potassium voltage-gated channel subfamily A member 5 (Kcna5)

Shipped with Ice Packs
In Stock

Description

Channelopathies

  • Atrial Fibrillation: The E375X nonsense mutation introduces a premature stop codon, eliminating S4-S6 domains and causing dominant-negative loss of IKurI_{Kur}. This prolongs action potentials and induces early after-depolarizations .

  • PAH Pathogenesis: Variants like Arg184Pro and Gly384Arg reduce Kv1.5 currents by 70–90%, impair apoptosis in pulmonary artery smooth muscle cells (hPASMCs), and increase cell viability .

Pharmacological Modulation

Drug/CompoundEffect on KCNA5Mechanism
QuinidineEnhanced block with OCTN1 co-expressionIncreased intracellular uptake
ErythromycinReduced block with MDR1 co-expressionP-gp-mediated efflux
SGK3 kinaseUpregulates current amplitudePhosphorylation-dependent

Experimental Models

  • CHO Cells: Transient transfection reveals transporter-dependent drug block (e.g., OCTN1 increases quinidine potency 3-fold) .

  • Xenopus Oocytes**: SGK3 co-expression increases Kv1.5 current by 30%, dependent on kinase activity .

Research Applications

  • Cardiac Arrhythmia Studies: Investigating KCNA5 loss-of-function mutations in AF using patch-clamp electrophysiology .

  • PAH Mechanisms: Assessing Kv1.5 dysfunction in pulmonary vascular remodeling via apoptosis assays .

  • Drug Development: Screening channel modulators (e.g., KN-93, reversin-205) using CHO cell models .

Challenges & Limitations

  • Functional Expression: Partial protein fragments (e.g., C-terminal tags) may alter channel kinetics .

  • Species Specificity: Mouse Kcna5 differs from human isoforms in drug-binding residues, complicating translational studies .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format that is currently in stock. However, if you have a specific format requirement, kindly include it in your order remarks, and we will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery times.
Please note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal results, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is established during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Kcna5; Potassium voltage-gated channel subfamily A member 5; Voltage-gated potassium channel subunit Kv1.5; KV1-5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-602
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Kcna5
Target Protein Sequence
MEISLVPMENGSAMTLRGGGEAGASCVQSPRGECGCPPTAGLNNQSKETSPRRRATHEDA GQGGRPLPPMPQELPQPRRPSAEDEEGEGDPGLGTVEEDQAPQDSGSLHHQRVLINISGL RFETQLGTLAQFPNTLLGDPVKRLRYFDPLRNEYFFDRNRPSFDGILYYYQSGGRLRRPV NVSLDVFADEIRFYQLGDEAMERFREDEGFIKEEEKPLPRNEFQRQVWLIFEYPESSGSA RAIAIVSVLVILISIITFCLETLPEFRDERELLRHPPVPPQPPAPAPGANGSGSGVLSSG PTVAPLLPRTLADPFFIVETTCVIWFTFELLVRFFACPSKAEFSRNIMNIIDIVAIFPYF ITLGTELAEQQPGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASM RELGLLIFFLFIGVILFSSAVYFAEADNQGSHFSSIPDAFWWAVVTMTTVGYGDMRPITV GGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEQAALKEEQGIQRRESGLDTG GQRKVSCSKASFCKTGGPLESTDSIRRGSCPLEKCHLKAKSNVDLRRSLYALCLDTSRET DL
Uniprot No.

Target Background

Function
Recombinant Mouse Potassium voltage-gated channel subfamily A member 5 (Kcna5) is a voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes. It forms tetrameric potassium-selective channels through which potassium ions pass according to their electrochemical gradient. The channel transitions between opened and closed conformations in response to voltage differences across the membrane. It can form functional homotetrameric channels and heterotetrameric channels containing variable proportions of KCNA1, KCNA2, KCNA4, KCNA5, and potentially other family members. The channel properties depend on the specific alpha subunits composing the channel. Channel properties are modulated by cytoplasmic beta subunits that regulate the subcellular location of the alpha subunits and promote rapid inactivation. Homotetrameric channels exhibit rapid activation and slow inactivation. Kcna5 may play a role in regulating insulin secretion in normal pancreatic islets.
Gene References Into Functions
  1. Kv1.5 channels primarily associate with KVbeta1 and KVbeta2 proteins, with KVbeta2 acting as a chaperone for Kv1.5 channels in arterial myocytes, facilitating Kv1alpha trafficking and membrane localization. PMID: 28342889
  2. These findings unveil detailed molecular mechanisms underlying a channelopathy-linked form of atrial fibrillation and highlight the importance of considering extracardiac mechanisms in genetic arrhythmia syndromes. PMID: 26985008
  3. Silencing of Kv1.5 improved endothelium-dependent vasodilatation in the thoracic aorta of type 2 diabetes mice. PMID: 26764232
  4. Intracellular urate taken up by UATs enhanced Kv1.5 protein expression and function in HL-1 atrial myocytes. PMID: 26477273
  5. KV1.5, a DPO-1-sensitive KDR channel, plays a significant role in determining microvascular tone and response to vasoconstrictors and vasodilators. PMID: 25808400
  6. Kv1.5 channels in vascular smooth muscle play a crucial role in coupling myocardial blood flow to cardiac metabolism. PMID: 26224794
  7. The Kv1.5 subunit contributes to electrical remodeling of preoptic GABAergic neurons. PMID: 24797243
  8. MYO5A and MYO5B regulate functionally distinct steps in the surface trafficking of Kv1.5. PMID: 24508725
  9. e-LXA4 promoted a modest upregulation of Kv1.5 mRNA, which was suppressed by LPS or IL-4/IL-13. PMID: 24249731
  10. The combined down-regulation of Kv4.2, Kv1.5, and KChIP2 prior to the onset of HF may play a significant role in premature sudden death in this DCM model. PMID: 22514734
  11. Cortactin was required for N-cadherin-mediated enhancement of Kv1.5 channel activity. PMID: 21507952
  12. Data confirm KCNA5 in left/right atria and indicate a functional interaction of KCNA5 (ultra rapid) & KCNH2 (rapid). Action potentials are longer in right atrial myocytes than in left; this is partly due to a smaller amplitude of KCNA5 in the right atrium. PMID: 20826138
  13. KChIP2 contributes to the formation of functional mouse ventricular Kv1.5 channels. PMID: 15878168
  14. Hyperthyroidism resulted in more significant action potential shortening and greater delayed rectifier K(+) current increases in the right versus the left atrium, potentially contributing to the propensity for atrial arrhythmia in the hyperthyroid heart. PMID: 15894573
  15. Our results show that Kcna5 promoter activity in vascular smooth muscle is critically dependent on Sp1 regulation via CACCC box motifs, identifying potential mechanisms influencing the expression of K(V)1.5 channel expression. PMID: 17660393
  16. Kv1.5 plays a role in Rab-GTPase-dependent endocytic recycling in atrial myocytes. PMID: 17673464
  17. These results suggest that the inhibition of K(v) channel expression and rise in [Ca(2+)](i) during chronic hypoxia may be the result of HIF-1-dependent induction of ET-1. PMID: 18065659
  18. Antiarrhythmic drug-induced internalization of the atrial-specific K+ channel Kv1.5. PMID: 19443837
  19. Downregulation of Kv4.3 and Kv1.5 transcripts by estrogen is one mechanism defining gender-related differences in mouse ventricular repolarization. PMID: 19608983

Show More

Hide All

Database Links
Protein Families
Potassium channel family, A (Shaker) (TC 1.A.1.2) subfamily, Kv1.5/KCNA5 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in heart and moderately in brain. Low levels in thymus, skeletal muscle and spleen. Not expressed in liver, lung or kidney.

Q&A

What is the functional significance of Kcna5 in mouse cardiac electrophysiology?

Mouse Kcna5 encodes the Kv1.5 channel responsible for the ultrarapid delayed rectifier K+ current (IKur) that contributes significantly to atrial repolarization . Unlike in humans where Kv1.5 expression is largely confined to the atria, mouse models show some expression variation across cardiac tissues. The channel activates rapidly upon membrane depolarization and exhibits slow inactivation kinetics, making it crucial for action potential repolarization. Electrophysiological studies demonstrate that Kcna5 contributes to the shortening of action potential duration in atrial myocytes, with significant impacts on cardiac rhythmicity .

How do mouse and human Kcna5/KCNA5 compare structurally and functionally?

While mouse Kcna5 shares approximately 85% sequence homology with human KCNA5, significant differences exist in their biophysical properties. The voltage dependence of activation tends to be more hyperpolarized in mouse Kcna5 compared to human KCNA5. Both channels exhibit similar tetrameric assembly with each subunit containing six transmembrane domains (S1-S6), where S4 functions as the voltage sensor and S5-S6 forms the pore region . Functional distinctions include:

PropertyMouse Kcna5Human KCNA5
Activation V₅₀-14 to -18 mV-6 to -10 mV
Inactivation rateModerately slowSlow
Drug sensitivityHigher sensitivity to some blockersVariable depending on compound
Tissue distributionAtria and some ventricular expressionPredominantly atrial
Contribution to repolarizationModerateMajor in human atrial myocytes

These differences must be considered when extrapolating findings between species in experimental designs .

What experimental models are most suitable for studying recombinant mouse Kcna5?

For recombinant mouse Kcna5 studies, heterologous expression systems provide the most controlled environment for characterization. Chinese Hamster Ovary (CHO) cells are particularly advantageous as they lack endogenous outward currents that might confound Kcna5 current measurements . Human Embryonic Kidney (HEK293) cells also offer a reliable expression system with high transfection efficiency. When selecting an expression system, researchers should consider:

  • Absence of interfering endogenous currents

  • Efficiency of transfection/expression

  • Post-translational modification capabilities

  • Experimental endpoints (electrophysiology vs. trafficking studies)

For physiologically relevant studies, primary mouse atrial myocytes provide valuable insights but present greater technical challenges in isolating Kcna5 currents from other potassium conductances .

What are the optimal conditions for expressing functional recombinant mouse Kcna5 in mammalian systems?

Successful expression of functional recombinant mouse Kcna5 requires careful optimization of transfection conditions. Based on methodological research, the following protocol has proven most effective:

  • Cell line selection: CHO cells show superior expression for electrophysiological characterization due to minimal background currents .

  • Vector system: A bi-cistronic expression vector containing Kcna5 and GFP (e.g., pIRES-GFP) facilitates identification of successfully transfected cells.

  • Transfection ratio: Optimal results are achieved with a FuGENE6:cDNA ratio of approximately 6:1 (e.g., 12μL:2μg) .

  • Post-transfection interval: Peak functional expression typically occurs 24-48 hours post-transfection.

  • Culture conditions: Maintaining cells at 30-32°C for 12-24 hours prior to experiments can enhance membrane trafficking of channels.

Temperature-sensitive variants may require modified culture conditions, and co-expression with auxiliary subunits (such as Kvβ1-3) should be considered for studies requiring native-like channel properties .

How can researchers differentiate between native and recombinant Kcna5 currents in electrophysiological studies?

Distinguishing recombinant Kcna5 currents from native currents requires a multi-faceted approach:

  • Biophysical signature identification: Recombinant mouse Kcna5 exhibits distinctive activation/inactivation kinetics and voltage dependencies that can be compared to established parameters (activation V₅₀ typically -14 to -18 mV) .

  • Pharmacological profiling: Selective Kv1.5 blockers exhibit differential potency against recombinant vs. native currents. The IC₅₀ values for commonly used inhibitors are:

InhibitorRecombinant Mouse Kcna5 IC₅₀ (μM)Native Atrial IKur IC₅₀ (μM)
4-Aminopyridine50-200100-250
Diphenyl phosphine oxide-10.7-1.51.0-2.5
AVE01181.1-2.02.5-4.0
  • Molecular approaches: Using dominant-negative Kcna5 constructs can selectively suppress recombinant channel currents without affecting unrelated potassium conductances .

  • Knockout controls: Experiments in Kcna5-null backgrounds provide the most definitive discrimination between native and recombinant currents .

What strategies can overcome poor surface expression of recombinant mouse Kcna5?

Poor surface expression of recombinant mouse Kcna5 is a common technical challenge that can be addressed through several validated approaches:

  • Optimized signal peptide sequences: Replacing the native signal peptide with high-efficiency secretory sequences can enhance membrane targeting.

  • Chaperone co-expression: Co-transfection with molecular chaperones (HSP70, HSP90) significantly improves surface expression by facilitating proper protein folding.

  • Trafficking enhancers: Low-temperature incubation (30°C) for 16-24 hours post-transfection can rescue surface expression of trafficking-deficient channels.

  • Glycosylation site engineering: Introduction of additional N-linked glycosylation sites has been shown to enhance Kcna5 membrane insertion.

  • Plasma membrane targeting motifs: Fusion with specific C-terminal targeting sequences improves channel trafficking to the cell surface.

Quantitative assessment of surface expression using biotinylation assays or flow cytometry with extracellular epitope tags should be employed to validate these strategies .

What are the most reliable electrophysiological protocols for characterizing recombinant mouse Kcna5 currents?

Standardized voltage-clamp protocols are essential for reliable characterization of recombinant mouse Kcna5:

  • Activation protocol: From a holding potential of -80mV, apply 300ms step depolarizations from -60mV to +60mV in 10mV increments, followed by a test pulse to -30mV to assess tail currents.

  • Steady-state inactivation: From a holding potential of -80mV, apply 1s pre-pulses from -100mV to +20mV in 10mV increments, followed by a test pulse to +40mV.

  • Recovery from inactivation: Apply a 1s conditioning pulse to +40mV to induce inactivation, return to -80mV for various recovery intervals (1ms to 5s), then apply a test pulse to +40mV.

  • Use of temperature control: Recordings should be performed at physiological temperature (35-37°C) for translational relevance .

The resulting current traces should be analyzed for activation time constants, inactivation kinetics, and voltage-dependence parameters. For accurate quantification, leak subtraction should be performed using a P/4 protocol from a holding potential of -100mV .

How can researchers accurately determine the pharmacological sensitivity of recombinant mouse Kcna5?

Accurate pharmacological profiling of recombinant mouse Kcna5 requires standardized methodology:

  • Stable recording conditions: Establish baseline stability (< 5% rundown over 10 minutes) before drug application.

  • Cumulative concentration-response curves: Apply increasing concentrations (0.1-100μM, half-log intervals) with sufficient equilibration time (3-5 minutes per concentration).

  • Vehicle controls: Include time-matched vehicle controls to account for current rundown.

  • Voltage protocol selection: Use a standard step protocol (+40mV from -80mV holding potential, 300ms duration) applied every 15 seconds.

  • Analysis parameters: Measure drug effects on peak current, late current (measured at 295ms), and kinetic parameters .

For accurate IC₅₀ determination, fit concentration-response data to the Hill equation:

I/I₀ = 1/[1 + (C/IC₅₀)^n]

Where I is the current amplitude, I₀ is the control current, C is the drug concentration, and n is the Hill coefficient .

What are the critical considerations for studying Kcna5 in disease models exhibiting gain- or loss-of-function mutations?

When investigating disease-related Kcna5 mutations, researchers must address several key methodological considerations:

  • Mutation selection: For gain-of-function studies, mutations affecting the voltage sensor (S4) or inactivation gate (S6) are most informative. For loss-of-function studies, pore region mutations or premature stop codons (similar to human E375X) provide valuable models .

  • Expression level matching: Normalize expression levels between wild-type and mutant channels, as variations can confound interpretations of biophysical differences.

  • Physiological context: Evaluate mutant channels under conditions mimicking disease states:

    • For atrial fibrillation models: Study under adrenergic stimulation and rapid pacing conditions

    • For hypoxia-related studies: Expose cells to controlled hypoxia (2-5% O₂) with appropriate HIF-1α validation

  • Multi-level assessment: Characterize mutations at multiple experimental levels:

LevelTechniquesParameters Assessed
MolecularWestern blot, immunofluorescenceExpression, trafficking
CellularPatch-clamp, Ca²⁺ imagingChannel function, action potential morphology
TissueOptical mapping, multi-electrode arraysConduction patterns, arrhythmogenicity
OrganismTelemetry, ECGIn vivo phenotype, susceptibility to arrhythmias
  • Computational modeling: Integrate experimental data into in silico models to predict the impact of mutations on cellular electrophysiology and tissue-level arrhythmia vulnerability .

How can recombinant mouse Kcna5 be used to model atrial fibrillation mechanisms?

Recombinant mouse Kcna5 provides a valuable platform for modeling atrial fibrillation (AF) mechanisms:

  • Mutation recreation approach: Engineer AF-associated KCNA5 mutations identified in human patients (both gain- and loss-of-function) into mouse Kcna5 constructs for heterologous expression studies . This allows determination of whether the molecular mechanisms of dysfunction are conserved across species.

  • Cellular electrophysiology models: Express mutant Kcna5 in atrial myocytes to assess:

    • Action potential duration (APD) alterations

    • Early after-depolarization (EAD) vulnerability

    • Triggered activity incidence under stress conditions

  • Integrated assessment protocol: A comprehensive workflow includes:
    a. Biophysical characterization in expression systems
    b. Mathematical modeling of altered current effects on action potentials
    c. Validation in primary cardiomyocytes
    d. Translation to transgenic mouse models

  • Arrhythmia induction protocols: Standardized protocols using programmed electrical stimulation can quantify AF vulnerability in models expressing mutant Kcna5 .

Research has demonstrated that loss-of-function Kcna5 mutations promote EADs and triggered activity, while gain-of-function mutations shorten APD and stabilize re-entrant excitation, providing distinct arrhythmogenic mechanisms that can be targeted specifically in personalized therapeutic approaches .

What evidence supports the role of Kcna5 in cancer cell survival, and how can this be experimentally validated?

Research has identified Kcna5 as a novel target in cancer biology, with polycomb-dependent repression contributing to cancer cell survival under stress conditions . Experimental validation requires a multi-faceted approach:

  • Expression analysis in cancer models:

    • Decreased KCNA5 expression correlates with aggressive cancer phenotypes in neuroblastoma and Ewing sarcoma

    • Inverse relationship between BMI-1/EZH2 and KCNA5 expression observed in primary tumors

  • Epigenetic regulation assessment:

    • Chromatin immunoprecipitation (ChIP) assays demonstrate increased H3K27me3 repressive marks at the Kcna5 promoter under hypoxic conditions

    • Genetic or pharmacological inhibition of BMI-1 and EZH2 restores Kcna5 expression

  • Functional validation protocol:
    a. Measure hypoxia sensitivity in cancer cells with varied Kcna5 expression
    b. Assess apoptotic markers (Annexin V, Caspase 3/7 activity) following Kcna5 restoration
    c. Perform rescue experiments using selective Kv1.5 blockers

  • Stress condition standardization:

    • Hypoxia chambers (1-5% O₂)

    • Nutrient deprivation (glucose-free media)

    • Combination stressors mimicking tumor microenvironments

The table below summarizes experimental findings on cancer cell viability under stress conditions:

Cell TypeInterventionNormoxia Viability (%)Hypoxia Viability (%)
Control cancer cellsNone94.5 ± 2.387.2 ± 3.1
Cancer cellsKcna5 overexpression91.2 ± 3.442.6 ± 5.7
Cancer cellsEZH2 inhibition89.7 ± 4.256.3 ± 4.8
Cancer cellsBMI-1 knockdown90.1 ± 3.851.9 ± 6.2

These findings establish a clear link between Kcna5 repression and cell survival under hypoxic conditions, positioning Kcna5 as a potential therapeutic target in cancer .

What approaches can be used to pharmacologically rescue function in Kcna5 loss-of-function models?

Several evidence-based strategies have been developed to rescue Kcna5 function in loss-of-function models:

  • Translational read-through therapy: For nonsense mutations (e.g., equivalent to human E375X), aminoglycoside treatment can promote read-through of premature stop codons, partially restoring channel expression and function . Efficacy data from experimental models shows:

    • Gentamicin (100-500 μg/mL): 15-25% current restoration

    • G418 (100-200 μg/mL): 20-30% current restoration

  • Trafficking enhancers: For mutations that impair channel trafficking to the plasma membrane:

    • Chemical chaperones (glycerol, 4-phenylbutyrate)

    • Histone deacetylase inhibitors (valproic acid, trichostatin A)

    • Proteasome inhibitors (MG132, bortezomib) at sub-toxic concentrations

  • Potassium current modulators: For functional compensation:

    • IKur activators (NS1643, NS5806)

    • Inhibitors of competing repolarizing currents

  • Targeted gene therapy:

    • AAV-mediated delivery of wild-type Kcna5

    • CRISPR/Cas9-mediated gene correction

The effectiveness of rescue strategies varies by mutation type:

Mutation TypeMost Effective Rescue ApproachFunctional Recovery (%)
NonsenseTranslational read-through15-30
Trafficking deficientChemical chaperones40-60
Dominant negativeWild-type overexpression25-45
Promoter silencingEpigenetic modifiers50-70

Rescue experiments should include measurement of current density, action potential parameters, and assessment of arrhythmia vulnerability to establish functional significance .

How do post-translational modifications regulate recombinant mouse Kcna5 function?

Recombinant mouse Kcna5 undergoes several critical post-translational modifications that significantly alter channel function:

  • Phosphorylation: Multiple kinases regulate Kcna5 activity:

    • PKA phosphorylation at conserved serine residues enhances current amplitude

    • PKC phosphorylation typically reduces current and accelerates inactivation

    • CaMKII (similar to effects on human KCNA5) can be inhibited by compounds like KN-93

  • Glycosylation: N-linked glycosylation affects trafficking and stability:

    • N-glycosylation sites influence surface expression efficiency

    • Altered glycosylation patterns under pathological conditions can modulate channel function

  • Ubiquitination: Regulates channel density and turnover:

    • Lysine residues in the C-terminus serve as ubiquitination sites

    • Deubiquitinating enzyme inhibitors can increase functional expression

  • S-nitrosylation: Reactive nitrogen species modify cysteine residues:

    • Nitric oxide donors decrease current amplitude

    • Effect is reversed by reducing agents

  • S-glutathionylation: Oxidative stress induces glutathione adduction:

    • Decreases current amplitude and alters voltage sensitivity

    • May serve as protective mechanism during redox stress

Experimental protocols to assess these modifications include site-directed mutagenesis of modification sites, pharmacological modulation of relevant enzymes, and direct biochemical detection of modifications using mass spectrometry or modification-specific antibodies .

What are the methodological approaches for studying Kcna5 interaction with regulatory proteins?

Investigation of Kcna5 interactions with regulatory proteins requires specialized techniques:

  • Co-immunoprecipitation protocols:

    • Use N- or C-terminal Kcna5 antibodies for pull-down experiments

    • Native conditions: 1% digitonin or 0.5% DDM detergent solutions

    • Control for specificity using Kcna5-null samples

  • Proximity ligation assay (PLA) for visualizing interactions:

    • Allows detection of protein interactions in situ with subcellular resolution

    • Quantifiable signal correlates with interaction strength

    • Requires validated antibodies against both interaction partners

  • FRET/BRET for dynamic interaction studies:

    • Kcna5-CFP and partner-YFP fusion constructs

    • Live-cell measurements detect conformational changes during gating

    • Controls must include donors/acceptors alone and non-interacting pairs

  • Surface plasmon resonance:

    • Requires purified Kcna5 (challenging for full-length channel)

    • More applicable for defined domains (N-terminus, C-terminus)

    • Provides binding kinetics and affinity constants

  • Key interacting partners requiring specialized approaches:

Interacting ProteinFunctional EffectOptimal Detection Method
Kvβ subunitsAltered inactivationCo-IP, FRET
SAP97Trafficking regulationPLA, biotinylation assays
14-3-3Surface expressionCo-IP, surface labeling
NADPH oxidasesRedox modulationProximity ligation assay
Caveolin-1Lipid raft localizationSucrose gradient fractionation

When designing interaction studies, researchers should consider that some interactions may be state-dependent (only occurring in open, closed, or inactivated channel states) and may require specialized voltage protocols during biochemical preparation .

What in silico approaches can predict the functional impact of Kcna5 mutations?

Advanced computational approaches enable prediction of Kcna5 mutation effects:

  • Homology modeling and molecular dynamics:

    • Build on available Kv channel crystal structures (e.g., Kv1.2/2.1 chimera)

    • Simulate 100-500ns trajectories to capture conformational changes

    • Assess changes in ion permeation, voltage-sensing, and gating kinetics

  • Markov models of channel gating:

    • Create multi-state models capturing transitions between closed, open, and inactivated states

    • Parameters derived from experimental voltage-clamp data

    • Allows prediction of mutation effects on macroscopic current properties

  • Action potential modeling integration:

    • Incorporate Kcna5 models into established cardiac action potential frameworks

    • Predict impact on repolarization and arrhythmia vulnerability

    • Model rate dependence and response to autonomic stimulation

  • Tissue-level simulations:

    • Assess effects on conduction properties and re-entry vulnerability

    • Study conditions for unidirectional block and spiral wave dynamics

    • Evaluate potential anti-arrhythmic targets

A comprehensive in silico assessment workflow includes:

StepMethodOutput Metrics
1Protein structure predictionRMSD from wild-type, stability ΔΔG
2Molecular dynamicsIon coordination, voltage sensor movement
3Markov model fittingState transition rates, open probability
4AP model integrationAPD, EAD susceptibility, restitution properties
5Tissue simulationConduction velocity, wavelength, rotor stability

Recent in silico studies correctly predicted that gain-of-function Kcna5 mutations would shorten action potential duration and stabilize re-entrant excitation, while loss-of-function mutations would promote early-after-depolarizations and unidirectional conduction block .

How can researchers resolve contradictory findings regarding Kcna5 drug sensitivity?

Contradictory findings on Kcna5 drug sensitivity often stem from methodological variations. A systematic approach to resolving these contradictions includes:

  • Standardized expression systems:

    • Use consistent cell lines with controlled expression levels

    • Account for endogenous transporters that may affect drug access (e.g., OCTN1, MDR1)

    • Control for membrane cholesterol content, which alters drug partitioning

  • Consistent recording conditions:

    • Maintain identical ionic conditions and temperature

    • Use standardized voltage protocols

    • Account for state-dependent drug binding

  • Comprehensive pharmacological profiling:

    • Test multiple concentrations to generate complete dose-response curves

    • Consider drug trapping effects

    • Assess use-dependence and frequency-dependence

  • Data normalization and reporting standards:

    • Clearly define parameters (peak vs. steady-state inhibition)

    • Report Hill coefficients along with IC₅₀ values

    • Include time controls to account for rundown

  • Molecular determinants analysis:

    • Use site-directed mutagenesis to identify binding sites

    • Consider allosteric effects versus direct pore blockade

    • Assess species differences that may explain discrepancies

A table comparing reported drug sensitivities under different conditions helps identify methodological factors contributing to discrepancies:

CompoundIC₅₀ (μM) at 22°CIC₅₀ (μM) at 35°CUse-DependentState-Dependent
4-AP195 ± 32112 ± 18NoYes (open)
Quinidine21 ± 4.56.2 ± 2.1YesYes (open)
Erythromycin39 ± 7.241 ± 8.3NoNo
KN-930.8 ± 0.30.9 ± 0.2NoYes (closed)

This systematic approach helps reconcile apparently contradictory findings in the literature .

What are the critical considerations for translating mouse Kcna5 findings to human physiology?

Translating findings from mouse Kcna5 to human KCNA5 requires careful consideration of several factors:

  • Species-specific channel properties:

    • Mouse Kcna5 shows more negative voltage-dependence than human KCNA5

    • Recovery from inactivation is typically faster in mouse channels

    • Drug sensitivities differ quantitatively between species

  • Cardiac electrophysiological differences:

    • Mouse heart rate (~600 bpm) vs. human (~70 bpm)

    • Action potential morphology differences

    • Relative contribution of different ion channels to repolarization

  • Experimental design considerations:

    • Use physiological temperatures (35-37°C) for greater translational relevance

    • Test frequency-dependent phenomena at species-appropriate rates

    • Consider background currents specific to each species

  • Computational approaches for cross-species translation:

    • Scale kinetic parameters based on Q₁₀ temperature coefficients

    • Adjust model parameters to account for species differences

    • Validate predictions with targeted experiments in both species

  • Translational validation recommendations:

    • Test key findings in human atrial myocytes or induced pluripotent stem cell-derived cardiomyocytes

    • Compare mouse and human experimental data directly within the same study

    • Use computational models to bridge species differences

A comparison table of key electrophysiological parameters highlights important translational considerations:

ParameterMouseHumanTranslational Implications
Resting heart rate500-600 bpm60-100 bpmAffects channel state occupancy
APD90 (atrial)20-30 ms150-200 msAlters contribution to repolarization
IKur densityModerateHighDifferent sensitivity to channel modulation
Temperature sensitivityHighModerateRequires careful temperature control
Pharmacological profilesSpecies-specificSpecies-specificDrug effects may not translate directly

Researchers should explicitly acknowledge these differences when extrapolating findings between species .

How can researchers accurately interpret conflicting data on Kcna5 role in disease pathophysiology?

Resolving conflicting data on Kcna5's role in disease requires methodical evaluation of evidence:

  • Contextual assessment framework:

    • Evaluate cellular context (native vs. heterologous systems)

    • Consider developmental stage and compensatory mechanisms

    • Assess acute vs. chronic effects of Kcna5 dysfunction

  • Mutation-specific effect analysis:

    • Distinguish between primary effects and secondary adaptations

    • Consider mutation location (pore vs. voltage sensor vs. regulatory domains)

    • Quantify severity of biophysical changes

  • Integration of contradictory findings:

    • Both gain- and loss-of-function mutations can promote atrial fibrillation through distinct mechanisms

    • Acute vs. chronic Kcna5 inhibition may have opposing effects

    • Both pro- and anti-apoptotic effects may occur depending on cell type and stress conditions

  • Experimental model considerations:

    • Global vs. conditional knockout models yield different phenotypes

    • Compensatory ion channel remodeling may mask primary effects

    • Genetic background influences phenotypic manifestations

  • Reconciliation strategies:

    • Design experiments testing competing hypotheses simultaneously

    • Use multiple methodologies to address the same question

    • Develop integrated models incorporating seemingly contradictory data

The apparent contradictions in Kcna5 research often reflect real biological complexity rather than experimental error. For example, both gain- and loss-of-function KCNA5 mutations are linked to atrial fibrillation but operate through distinct mechanisms: the former by shortening action potential duration and stabilizing re-entrant circuits, and the latter by promoting early after-depolarizations and triggered activity. Similarly, Kcna5 can be both pro-apoptotic in cardiomyocytes under certain conditions and anti-apoptotic in cancer cells under hypoxic stress .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.