Recombinant Mouse Potassium voltage-gated channel subfamily A member 7 (Kcna7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
Kcna7; Kcnc7; Potassium voltage-gated channel subfamily A member 7; Voltage-gated potassium channel subunit Kv1.7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-489
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Kcna7
Target Protein Sequence
MLFLPADTGHPTGVAAASGPHVRSPVARAVRAMEPRCPPPCGCCERLVLNVAGLRFETRA RTLGRFPDTLLGDPVRRSRFYDGARREYFFDRHRPSFDAVLYYYQSGGRLRRPAHVPLDV FLEEVSFYGLGAAALARLREDEGCAVPPERPLPRRAFARQLWLLFEFPESSQAARVLAVV SVLVILVSIVVFCLETLPDFRDDRDDPGLAPVAAATGPFLARLNGSSPMPGAPPRQPFND PFFVVETLCICWFSFELLVRLVACPSKAVFFKNVMNLIDFVAILPYFVALGTELARQRGV GQPAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLRASMRELGLLIFFLFIGVVLFS SAVYFAEVDRVDTHFTSIPESFWWAVVTMTTVGYGDMAPVTVGGKIVGSLCAIAGVLTIS LPVPVIVSNFSYFYHRETEGEEAGMYSHVDTQPCGTLEGKANGGLVDSEVPELLPPLWPP AGKHMVTEV
Uniprot No.

Target Background

Function

This protein mediates the voltage-dependent potassium ion permeability of excitable membranes. It exists in open or closed conformations depending on the transmembrane voltage difference, forming a potassium-selective channel that allows potassium ion passage according to their electrochemical gradient. Isoform 1 channels inactivate faster than isoform 2 channels.

Gene References Into Functions
  1. Mouse heart muscle Kv1.7 channels possess two putative translation initiation sites, yielding two functionally distinct isoforms: mKv1.7L (489 amino acids) and the shorter mKv1.7S (457 amino acids). PMID: 16801386
Database Links
Protein Families
Potassium channel family, A (Shaker) (TC 1.A.1.2) subfamily, Kv1.7/KCNA7 sub-subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in heart, skeletal muscle, brain, and pancreatic islet cells.

Q&A

How does Kcna7 differ from other potassium channel family members?

Unlike other Kv1-family genes that contain intronless coding regions, both human KCNA7 and mouse kcna7 genes are encoded by two exons separated by a conserved intron . This unique genomic organization suggests distinct evolutionary origins or selective pressures. Additionally, while many potassium channels like Kv7.2-7.5 (KCNQ) have been extensively studied for their roles in neurological disorders , Kcna7 has been less thoroughly characterized despite its potential cardiac significance.

The mouse Kcna7 channel exhibits biophysical and pharmacological properties closely resembling the ultra-rapidly activating delayed rectifier (IKur) in cardiac tissue . This functional profile distinguishes it from other potassium channels that may have slower activation kinetics or different tissue-specific roles.

Where is Kcna7 primarily expressed in mammalian tissues?

Research using reverse transcriptase-PCR has detected KCNA7 mRNA in adult human heart tissue , suggesting a significant cardiac expression pattern. This expression profile correlates with the channel's functional similarity to the cardiac ultra-rapidly activating delayed rectifier current.

The expression pattern of mouse Kcna7 appears to be relatively restricted compared to some other potassium channels. While channels like Kv7.2-7.5 are broadly expressed throughout the nervous system, including hippocampal and cortical neurons as well as regions involved in neuropathic pain (dorsal and ventral horn of the spinal cord, dorsal root and trigeminal ganglion neurons) , Kcna7's expression appears more specialized.

Understanding the precise subcellular localization of Kcna7 requires immunohistochemical studies or expression of tagged constructs in relevant cell types. Researchers investigating Kcna7 localization should consider both tissue-level expression (through RT-PCR or Northern blotting) and cellular distribution (through immunohistochemistry or fluorescent protein tagging).

How does Kcna7 expression change under pathological conditions?

While the available search results do not directly address pathological regulation of Kcna7 expression, potassium channels generally show altered expression patterns in various disease states. By analogy with other potassium channels like Kv7.2, where mutations and expression changes are associated with epilepsy , Kcna7 expression might be affected in cardiac pathologies.

The human KCNA7 gene has been mapped to chromosome 19q13.3, a region that contains the progressive familial heart block I (PFHBI) locus . Although direct sequencing of KCNA7's coding sequence in PFHB1-affected individuals revealed no pathogenic sequence changes, two single nucleotide polymorphisms detected in exon 2 result in amino acid substitutions . These findings suggest potential involvement in cardiac pathophysiology that warrants further investigation.

What are the optimal conditions for recombinant expression of mouse Kcna7?

For recombinant expression of mouse Kcna7, E. coli has been successfully used as an expression system to produce the full-length protein (1-489 amino acids) with an N-terminal His tag . To ensure proper expression and protein quality:

  • Clone the full-length Kcna7 sequence into an appropriate expression vector with a His tag (preferably N-terminal)

  • Transform into an E. coli expression strain optimized for membrane protein expression

  • Induce expression under controlled conditions (temperature, inducer concentration)

  • Purify using affinity chromatography based on the His tag

  • Store the purified protein as a lyophilized powder to maintain stability

For functional studies of mouse Kcna7, researchers have successfully used transient transfection of COS-7 cells with a construct containing the corrected mouse kcna7 sequence cloned in-frame downstream of enhanced green fluorescent protein in the eGFP-C3 vector . Currents can be recorded 6–12 hours after transfection using patch-clamp electrophysiology.

What are the recommended storage and handling conditions for recombinant Kcna7 protein?

Based on the product specifications, recombinant Kcna7 protein should be stored according to the following guidelines:

  • Upon receipt, store at -20°C or -80°C

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • Short-term working aliquots can be stored at 4°C for up to one week

  • The lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) to aliquots for long-term storage at -20°C/-80°C

  • A default final concentration of 50% glycerol is recommended

  • Briefly centrifuge vials prior to opening to bring contents to the bottom

The protein is typically supplied in a Tris/PBS-based buffer containing 6% Trehalose, pH 8.0 , which helps maintain stability during storage and reconstitution.

What electrophysiological approaches are most suitable for studying Kcna7 channel properties?

Electrophysiological characterization of Kcna7 channels can be accomplished using several approaches:

  • Heterologous expression systems: COS-7 cells have been successfully used for recording Kcna7 currents following transient transfection . This approach allows for controlled expression and systematic mutation analysis.

  • Voltage-clamp protocols: Since Kcna7 exhibits properties similar to the ultra-rapidly activating delayed rectifier (IKur) in cardiac tissue , appropriate voltage-clamp protocols should include:

    • Step depolarizations from negative holding potentials

    • Measurements of activation and deactivation kinetics

    • Assessment of voltage-dependence of activation

    • Inactivation protocols at various holding potentials

  • Pharmacological characterization: Testing sensitivity to classic potassium channel blockers like TEA, 4-AP, or more specific blockers is essential to establish the pharmacological profile.

When comparing results between expression systems, researchers should be aware that channel properties may vary depending on the cell type used. Native cardiac cells or cardiac cell lines might provide a more physiologically relevant context than heterologous expression systems.

How can researchers distinguish between Kcna7 activity and other potassium channels in complex systems?

Distinguishing Kcna7 activity from other potassium channels requires a multi-faceted approach:

A combination of these approaches provides the most reliable method for isolating Kcna7 activity in complex systems like primary cardiac preparations.

How conserved is Kcna7 structure and function between mouse and human?

Mouse and human Kcna7 proteins exhibit remarkable conservation:

  • Both human KCNA7 and mouse kcna7 genes are encoded by two exons separated by a conserved intron, a genomic organization unique among Kv1-family genes .

  • The proteins encoded by KCNA7 and kcna7 share over 95% sequence identity, consisting of 456 amino acid residues (though another source indicates 489 amino acids for the mouse protein) .

  • The mouse channel exhibits biophysical and pharmacological properties closely resembling the ultra-rapidly activating delayed rectifier (IKur) in cardiac tissue, suggesting functional conservation .

What are the key differences between Kcna7 and other potassium voltage-gated channel subfamily members?

Kcna7 differs from other potassium channel subfamily members in several key aspects:

  • Genomic organization: Unlike other Kv1-family genes that contain intronless coding regions, both human KCNA7 and mouse kcna7 genes contain two exons separated by a conserved intron .

  • Functional properties: Kcna7 resembles the ultra-rapidly activating delayed rectifier (IKur) , whereas other channels like Kv7.2-7.5 underlie the M-current, which exhibits significant conductance in the voltage range of action potential generation and tends to allow firing of single action potentials while opposing sustained membrane depolarization and repetitive firing .

  • Tissue distribution: While Kv7.2-7.5 channels are broadly expressed in hippocampal and cortical neurons and in regions involved in neuropathic pain , Kcna7 appears to have a more cardiac-focused expression pattern .

  • Pathophysiological relevance: Mutations in Kv7.2 or Kv7.3 cause benign familial neonatal convulsions, an autosomal dominant epilepsy of infancy , while KCNA7 has been investigated for potential involvement in progressive familial heart block I .

What is the potential physiological significance of Kcna7 in cardiac function?

The expression of KCNA7 in adult human heart coupled with the functional similarity of mouse Kcna7 to the ultra-rapidly activating delayed rectifier (IKur) current in cardiac tissue suggests important roles in cardiac electrophysiology. Specifically:

  • The ultra-rapid activation kinetics of Kcna7 likely contribute to the early repolarization phase of the cardiac action potential.

  • The channel's location on chromosome 19q13.3 in a region containing the progressive familial heart block I (PFHBI) locus suggests potential involvement in cardiac conduction, though direct sequencing did not identify pathogenic mutations in PFHB1-affected individuals.

  • By analogy with other potassium channels, Kcna7 likely plays roles in setting resting membrane potential, determining action potential duration, and modulating cardiac excitability.

Understanding Kcna7's precise contribution to cardiac physiology requires further investigation using selective pharmacological tools or genetic approaches like conditional knockout models.

How does Kcna7 relate to disease pathophysiology and potential therapeutic targets?

While direct links between Kcna7 and disease have not been definitively established in the search results, several lines of evidence suggest potential relevance:

  • KCNA7 resides on chromosome 19q13.3 in a region containing the progressive familial heart block I (PFHBI) locus . Though direct sequencing didn't reveal pathogenic changes in the coding sequence, regulatory mutations remain possible.

  • Two single nucleotide polymorphisms detected in exon 2 of KCNA7 result in amino acid substitutions , which could potentially modify channel function in subtle ways.

  • By analogy with other potassium channels like Kv7.2-7.5, which are targets for treating neurological disorders , Kcna7 modulators might have therapeutic potential for cardiac arrhythmias or conduction disorders.

What experimental approaches can resolve contradictory findings in Kcna7 research?

To address contradictory findings in Kcna7 research, several sophisticated approaches can be employed:

  • Site-directed mutagenesis: Systematic mutation of key residues can help resolve structure-function relationships and explain divergent findings. For example, the published mouse cDNA sequence was found to contain an error that required correction for proper functional expression .

  • Heterologous expression in multiple systems: Testing the same constructs in different expression systems (Xenopus oocytes, mammalian cell lines, primary cardiac cells) can help determine if contradictory findings arise from the expression environment.

  • Single-channel recordings: While macroscopic current measurements provide useful information, single-channel recordings can reveal subtle functional differences that might explain contradictory results.

  • Computational modeling: By integrating biophysical data into computational models of excitable cells, researchers can better predict how specific Kcna7 properties translate to physiological or pathophysiological outcomes.

  • In vivo validation: Ultimately, animal models with targeted Kcna7 modifications provide the strongest validation of channel function and can help resolve contradictions from simpler systems.

The table below summarizes how different experimental approaches can address specific types of contradictory findings:

Type of ContradictionRecommended ApproachKey Considerations
Biophysical propertiesSingle-channel recordings, multiple expression systemsTemperature, ionic conditions, cell background
Expression patternsMultiple detection methods (RNA-seq, qPCR, in situ hybridization, immunohistochemistry)Antibody specificity, primer design, developmental stage
Disease associationsLarge-scale sequencing, functional validation of variantsPopulation stratification, phenotype definition, modifier genes
Pharmacological sensitivityDose-response curves in multiple systems, binding studiesDrug purity, off-target effects, species differences

How can researchers design experiments to elucidate the specific contribution of Kcna7 to integrated cellular functions?

Designing experiments to isolate Kcna7's specific contribution to cellular function requires sophisticated approaches:

  • Genetic manipulation strategies:

    • Conditional knockout models allowing tissue-specific and temporal control of Kcna7 expression

    • CRISPR/Cas9-mediated introduction of disease-associated variants

    • Selective overexpression or dominant-negative suppression approaches similar to those used for Kv7.2

  • Advanced electrophysiological techniques:

    • Dynamic clamp to simulate varying levels of Kcna7 current in real-time during cellular recordings

    • Action potential clamp to assess Kcna7 contribution during different phases of the action potential

    • Simultaneous measurement of membrane potential and intracellular calcium to link Kcna7 activity to calcium handling

  • Multi-cellular and tissue-level analyses:

    • Optical mapping of cardiac tissue with Kcna7 manipulation to assess effects on conduction velocity and action potential propagation

    • Multi-electrode array recordings to evaluate network properties affected by Kcna7 function

    • Ex vivo perfused heart preparations to assess arrhythmia susceptibility

  • Integration with computational modeling:

    • Incorporation of experimentally-determined Kcna7 properties into detailed cardiac cell models

    • Sensitivity analysis to identify critical parameters determining Kcna7's functional impact

    • Multi-scale modeling from molecular to tissue level to predict integrated effects

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.