Recombinant Mouse Potassium voltage-gated channel subfamily C member 1 (Kcnc1)

Shipped with Ice Packs
In Stock

Description

Production and Validation

Recombinant Kcnc1 is generated using multiple platforms to accommodate diverse experimental needs:

Expression Systems

  • Bacterial (E. coli): Cost-effective for large-scale production but may lack post-translational modifications .

  • Mammalian Cells: Retains native folding and glycosylation patterns, suitable for electrophysiological studies .

  • Cell-Free Systems: Enables rapid production of truncated or mutated variants for structure-function analysis .

Quality Control

  • Purity assessed via SDS-PAGE and Coomassie staining .

  • Functional validation using automated two-electrode voltage clamping in Xenopus oocytes or patch-clamp electrophysiology in HEK293 cells .

Mechanistic Studies of Channel Dysfunction

  • Loss-of-Function Mutants: The p.Ala421Val variant reduces whole-cell potassium currents by ~50% in cerebellar Purkinje cells, impairing action potential repolarization .

  • Trafficking Deficits: Mutant Kcnc1 (e.g., p.Arg320His) disrupts membrane localization, as shown in HEK293 cells and induced pluripotent stem cell (iPSC)-derived neurons .

Disease Modeling

  • Epilepsy: Kcnc1-A421V knock-in mice exhibit spontaneous seizures, mimicking developmental and epileptic encephalopathies (DEEs) in humans. Reduced Kv3.1 currents lead to hyperexcitability in parvalbumin-positive interneurons .

  • Ataxia: Impaired Kv3.1 function in cerebellar neurons correlates with motor coordination deficits, a hallmark of myoclonus epilepsy and ataxia (MEAK) .

Drug Discovery

  • Kv3.1 Activators: The small molecule RE01 rescues channel activity in mutant Kcnc1-expressing cells, suggesting therapeutic potential for Kcnc1-related epilepsy .

  • High-Throughput Screening: Recombinant Kcnc1 is used to identify modulators in fluorometric or electrophysiology-based assays .

Electrophysiological Phenotypes

  • Current Density: Recombinant Kcnc1-A421V channels show a 50–70% reduction in potassium current density in nucleated macropatch recordings from mouse brain slices .

  • Synaptic Transmission: PV-INs expressing mutant Kcnc1 exhibit altered GABA release kinetics, impacting inhibitory circuit dynamics .

Detection and Quantification

  • ELISA Kits: Mouse-specific assays (e.g., Abbexa’s kit) detect Kcnc1 in tissue homogenates with a sensitivity of <0.05 ng/ml and a linear range of 0.156–10 ng/ml .

  • Immunoblotting: Antibodies targeting extracellular domains (e.g., residues 200–300) validate surface expression in neuronal membranes .

Challenges and Future Directions

  • Trafficking Rescue: Developing chaperones to restore membrane localization of mutant Kcnc1 .

  • Isoform-Specific Roles: Distinguishing contributions of Kv3.1a (developmental) vs. Kv3.1b (adult) isoforms in disease .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Kcnc1; Potassium voltage-gated channel subfamily C member 1; NGK2; Voltage-gated potassium channel subunit Kv3.1; Voltage-gated potassium channel subunit Kv4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-511
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Kcnc1
Target Protein Sequence
MGQGDESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRH PGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALD SFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALF EDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKTEIENVRNGTQVRYYREAE TEAFLTYIEGVCVVWFTFEFLMRVVFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSS KAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFA TMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALC ALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKKKHIPRPPQLGSPNYCKSVVNSPH HSTQSDTCPLAQEEILEINRAGRKPLRGMSI
Uniprot No.

Target Background

Function
Voltage-gated potassium channel KCNC1 plays a critical role in the rapid repolarization of fast-spiking neurons in the brain. Membrane voltage changes trigger channel opening, creating a potassium-selective pore that facilitates potassium ion flow according to their electrochemical gradient. KCNC1 forms functional homotetrameric and heterotetrameric channels, potentially incorporating varying proportions of KCNC2 and other family members. This channel contributes to the sustained high-frequency firing of brief action potentials in pallidal neurons.
Gene References Into Functions
  1. Kv3.1 channels stimulate adult neural precursor cell proliferation and neuronal differentiation. PMID: 23478135
  2. The resting (closed) Kv3.1 channel conformation represents the high-affinity state for gambierol. PMID: 23401573
  3. High-affinity multimeric binding between the Kv3.1 T1 domain and KIF5B requires three basic residues in the KIF5B tail. Kv3.1 T1 competes with the motor domain and microtubules, but not with kinesin light chain 1 (KLC1), for KIF5B tail binding. PMID: 23487040
  4. While all Kv3 transcripts showed significant embryonic expression in whole brain extracts, only Kv3.1, Kv3.2, and Kv3.4 subunit proteins were detected, suggesting a novel developmental role for Kv3 channels. PMID: 21912965
  5. Kv3.1 channel blockade hinders spike repolarization and severely reduces evoked fast firing in deep cerebellar nuclear neurons. PMID: 21750937
  6. Mice lacking both Kcnc1 and Kcnc2 genes exhibit absent Kv3.1 and Kv3.2 channel expression in the suprachiasmatic nucleus. PMID: 21414897
  7. Acoustically driven auditory activity selectively regulates high-threshold potassium currents in the MNTB of normal hearing mice, likely through increased membrane expression of Kv3.1b channels. PMID: 20946234
  8. Progressive loss of Kcnc1, but not Kcnc3, alleles in mutant mice results in increasing gait ataxia, accompanied by spike broadening and deceleration in deep cerebellar nuclei neurons. PMID: 20016089
  9. Interaction with CALP/KCHIP4. PMID: 11847232
  10. NCS-1 is an accessory subunit of Kv4-encoded I(to,f) channels regulating I(to,f) density in the mammalian myocardium. PMID: 11994284
  11. Kv4.3, along with K(+) channel-interacting proteins, is the primary determinant of A-type potassium current in murine colonic myocytes. PMID: 12381814
  12. Modulation of the Kv3.1b potassium channel isoform adjusts the precision of auditory neuron firing patterns. PMID: 12598601
  13. Motor deficits and altered synaptic transmission at the parallel fiber-Purkinje cell synapse are observed in Kv3.1 knockout mice. PMID: 12930807
  14. Ongoing activity in auditory brainstem neurons maintains Kv3.1 tonotopicity via the CREB pathway. PMID: 14985434
  15. Double mutant Kv3.1/Kv3.3-deficient mice exhibit constitutive hyperactivity. Increased ambulatory and stereotypic activity, along with sleep loss, is seen in Kv3.1-single mutants but not in Kv3.3-single mutants. PMID: 15005717
  16. Starburst amacrine cells exhibit large outward currents partly mediated by the Kv3.1 channel. PMID: 15317859
  17. Renshaw cells express Kv3.1b weakly from postnatal day 14, and strongly at postnatal day 21. PMID: 16460880
  18. Kv3.1 and Kv3.3 voltage-gated potassium channels regulate sleep in wild-type and Kv3-mutant mice. PMID: 16553620
  19. Calcineurin and NFATc3 form a Ca(2+)-driven signaling module contributing to the uneven distribution of Kv4 expression, and thus Ito function, in the mouse left ventricle. PMID: 16614306
  20. K(V)3.1 K(+) current constitutes a significant portion of the total K(+) current in oligodendrocyte lineage and, in conjunction with OSP/claudin-11, plays a significant role in OPC proliferation, migration, and axonal myelination. PMID: 16624990
  21. Altered electrophysiological properties of thalamic reticular nucleus (TRN) neurons contribute to reduced slow-frequency EEG power in the thalamocortical network of Kv3-deficient mice. PMID: 18495891
  22. Kv3.1 is expressed in both GAD- and GAD+ cells, albeit at different densities and distributions. They likely contribute to the distinct biophysical properties of both cell types in the dentate nucleus. PMID: 18682278
Database Links
Protein Families
Potassium channel family, C (Shaw) (TC 1.A.1.2) subfamily, Kv3.1/KCNC1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, axon. Cell junction, synapse, presynaptic cell membrane.
Tissue Specificity
Detected in cerebellum. Detected in brain (at protein level). Detected in brain.

Q&A

What is the molecular structure of mouse Kcnc1 and how does it compare to human KCNC1?

Mouse Kcnc1, also known as Kv3.1, is a voltage-gated potassium channel containing 6 transmembrane segments (S1-S6) with a voltage-sensor domain in S4. The mouse protein shares high homology with human KCNC1, with both forming tetrameric channels that can exist as homotetramers or heterotetramerize with other Kv3 family members. The mouse Kcnc1 gene has multiple aliases including KV4, NGK2, Shaw, Kv3.1, Kcr2-1, KShIIIB, and C230009H10Rik .

The full amino acid sequence of mouse Kcnc1 shows significant conservation in the pore-forming and voltage-sensing regions compared to human KCNC1, with differences primarily in the C-terminal regulatory domain. When working with recombinant mouse Kcnc1, researchers should note that commercially available proteins typically have ≥85% purity as determined by SDS-PAGE, suitable for most experimental applications .

What are the primary expression patterns and functional roles of Kcnc1 in the mouse nervous system?

Kcnc1 is highly and selectively expressed in neurons capable of generating action potentials at high frequency, with particular abundance in:

  • Parvalbumin-positive fast-spiking GABAergic inhibitory interneurons (PV-INs) in the neocortex and hippocampus

  • Cerebellar granule and Purkinje cells

  • Neurons of the reticular thalamus

  • Globus pallidus

  • Subthalamic nucleus

  • Substantia nigra

Functionally, Kcnc1 channels exhibit unique biophysical properties including depolarized voltage-dependence of activation, fast activation and deactivation rates, and minimal inactivation. These properties are exquisitely tuned to generate brief spikes with limited inter-spike intervals, supporting the rapid cycling required for reliable fast-spiking in Kcnc1-expressing neurons . The channel plays a critical role in the rapid repolarization phase of action potentials in fast-firing neurons, enabling high-frequency firing .

What are the optimal expression systems for producing functional recombinant mouse Kcnc1 protein?

Recombinant mouse Kcnc1 can be produced in several expression systems, each with distinct advantages:

Expression SystemAdvantagesLimitationsTypical YieldApplications
E. coliCost-effective, high yield, rapid productionLimited post-translational modifications, potential improper folding of membrane proteins5-10 mg/LStructural studies, antibody production
YeastEukaryotic processing, moderate costSome differences in glycosylation patterns2-5 mg/LBasic functional studies
Baculovirus/Insect CellsMore mammalian-like post-translational modificationsHigher cost, longer production time1-3 mg/LFunctional/interaction studies
Mammalian CellsNative-like folding and modificationsHighest cost, lower yield0.5-2 mg/LElectrophysiology, trafficking studies
Cell-Free ExpressionRapid, avoids cell toxicity issuesLimited post-translational modificationsVariableRapid screening approaches

For functional studies requiring proper channel assembly and membrane insertion, mammalian expression systems (particularly HEK-293T cells) are typically preferred. For structural studies requiring larger quantities, E. coli or insect cell systems may be more appropriate, with subsequent refolding strategies if necessary .

What electrophysiological approaches are most effective for characterizing Kcnc1 channel properties?

Multiple electrophysiological techniques have been successfully employed to characterize Kcnc1 function:

  • Whole-cell patch clamp: Provides comprehensive assessment of channel properties in heterologous expression systems or native neurons. Key parameters to measure include:

    • Voltage-dependent activation (typically at depolarized potentials)

    • Fast activation and deactivation kinetics

    • Current density (pA/pF)

    • Selectivity for potassium ions

  • Outside-out nucleated macropatch recordings: Particularly useful for measuring current density in specific neuronal populations like PV-INs in brain slices .

  • Co-expression studies: When investigating dominant-negative or dominant-positive effects of mutant channels, researchers should co-express wild-type and mutant channels (typically in a 1:1 ratio) to mimic the heterozygous state. This approach has revealed important mechanistic insights, such as the dominant-negative effects observed with p.Thr399Met and p.Ala421Val mutations .

For accurate characterization, voltage protocols should include:

  • Holding potential of -80 mV

  • Depolarizing steps from -70 to +70 mV in 10 mV increments

  • Measurement of tail currents for determining activation curves

  • Analysis of deactivation kinetics using repolarizing steps

How do different Kcnc1 mutations impact channel function and contribute to distinct neurological phenotypes?

Research has identified several pathogenic variants in Kcnc1/KCNC1 that result in distinct neurological phenotypes through different functional mechanisms:

MutationFunctional ImpactNeurological PhenotypeMechanismReference
p.Arg320HisLoss-of-function with dominant-negative effectProgressive myoclonus epilepsy, ataxiaReduced K+ current, altered PV-IN activity
p.Ala421ValLoss-of-function with dominant-negative effectDevelopmental and epileptic encephalopathy, moderate-to-severe developmental delayDecreased voltage-gated K+ current density in PV-INs, hypersynchronous network activity
p.Thr399MetLoss-of-function with possible dominant-positive effects when co-expressed with wild-typeDevelopmental delay and treatment-resistant myoclonic epilepsyHyperpolarized shift in voltage-dependence of activation, slowed deactivation kinetics
p.Cys208TyrLoss-of-function without dominant-negative effectIsolated non-progressive myoclonusNo measurable currents but minimal impact when co-expressed with WT
p.Arg339* (nonsense)Loss-of-functionIntellectual disability without seizures or epilepsyPremature truncation of protein

These findings demonstrate that different mutations in the same channel can produce diverse clinical phenotypes through distinct effects on channel function. Studies using co-expression of wild-type and mutant channels have been particularly informative in elucidating these mechanisms .

What are the key considerations when developing and characterizing mouse models of Kcnc1-related disorders?

When developing mouse models of Kcnc1-related disorders, researchers should consider:

  • Targeting strategy:

    • Global versus conditional expression of mutations

    • Heterozygous versus homozygous models

    • Knock-in versus transgenic approaches

  • Comprehensive phenotyping protocols:

    • Electrophysiological assessments (in vitro and in vivo)

    • Behavioral testing (cognitive, motor function)

    • Video-EEG monitoring for seizure characterization

    • Histological and immunohistochemical analyses

  • Age-dependent assessments:

    • Developmental trajectory is critical as some phenotypes may be progressive

    • Compare juvenile versus adult mice to capture developmental aspects

  • Cell-type specific analyses:

    • Focus on PV-INs where Kcnc1 is predominantly expressed

    • Compare effects on inhibitory versus excitatory neurons

A recent successful approach involved generating transgenic mice with conditional expression of the Kcnc1-A421V pathogenic variant (Kcnc1-A421V/+ mice) to explore physiological mechanisms of KCNC1 developmental and epileptic encephalopathy. This model demonstrated:

  • Global heterozygous expression led to epilepsy and premature lethality

  • Decreased PV-IN cell surface expression of Kv3.1

  • Reduced voltage-gated potassium current density in PV-INs

  • Impaired intrinsic excitability of cortical PV-INs but not excitatory neurons

  • Hypersynchronous discharges correlating with myoclonic seizures

  • Age-dependent alterations in inhibitory neurotransmission

How can electrophysiological and imaging techniques be combined to understand Kcnc1's role in neuronal circuit function?

Integrating electrophysiological and imaging approaches provides powerful insights into Kcnc1's role in neuronal circuits:

  • Two-photon calcium imaging combined with EEG:

    • Enables correlation between cellular-level activity and network-level outcomes

    • Has successfully revealed hypersynchronous discharges in Kcnc1-A421V/+ mice that correlate with brief paroxysmal movements, subsequently confirmed as myoclonic seizures via EEG

  • Optogenetic stimulation with electrophysiological recording:

    • Allows cell-type specific manipulation of PV-INs expressing mutant Kcnc1

    • Can assess the causal relationship between PV-IN dysfunction and network hyperexcitability

  • Ex vivo patch-clamp with immunohistochemistry:

    • Combining electrophysiological recording with post-hoc immunostaining

    • Enables correlation between functional deficits and protein expression/localization

A particularly informative methodology involves outside-out nucleated macropatch recordings in brain slices to measure current density in PV-INs, combined with in vivo two-photon calcium imaging to visualize network activity patterns. This approach revealed that Kcnc1 mutations produce profound impairments in the intrinsic excitability of cerebral cortex PV-INs while sparing excitatory neurons, resulting in network hyperexcitability .

What are the molecular mechanisms underlying the dominant-negative effects of Kcnc1 mutations?

The dominant-negative effects observed with certain Kcnc1 mutations involve complex molecular mechanisms:

  • Tetramerization interference:

    • Mutant subunits can assemble with wild-type subunits, forming dysfunctional heteromeric channels

    • Functional analyses demonstrate significantly decreased K+ current amplitudes (approximately 68% and 48% reduction for Thr399Met and Ala421Val mutants, respectively) when co-expressed with wild-type channels

  • Altered gating properties:

    • Some mutations (e.g., Ala421Val) induce a hyperpolarizing shift in the activation curve when co-expressed with wild-type channels

    • This alters the voltage-dependence of channel opening, affecting neuronal firing patterns

  • Trafficking defects:

    • Decreased cell-surface expression observed in Kcnc1-A421V models suggests potential defects in protein trafficking

    • Immunohistochemistry studies have confirmed reduced membrane localization of Kv3.1 in PV-INs in mutant models

  • Mutation-specific mechanisms:

    • The p.Thr399Met variant demonstrates a unique "dominant-positive" effect when co-expressed with wild-type, rescuing conductance but causing altered gating properties

    • This explains the distinctive clinical phenotype associated with this mutation

These findings highlight the importance of studying the biophysical properties of heteromeric channels containing both wild-type and mutant subunits to understand disease mechanisms accurately.

What therapeutic approaches are being developed for Kcnc1-related disorders?

Emerging therapeutic strategies for Kcnc1-related disorders include:

  • Repurposed compound screening:

    • Organizations like The KCNC1 Foundation are collaborating with research institutions to screen existing drug libraries

    • The Broad's repurposed compound library is being tested against specific Kv3.1 variants (e.g., V434L)

  • Channel modulators:

    • Compounds that enhance the remaining function of mutant channels

    • May be particularly effective for mutations with partial loss-of-function

  • Gene therapy approaches:

    • Antisense oligonucleotides to selectively suppress mutant allele expression

    • Gene replacement strategies for loss-of-function mutations

  • Cell-type specific interventions:

    • Targeting therapeutic interventions to PV-INs

    • Modulating inhibitory circuit function to compensate for Kcnc1 dysfunction

Current research suggests that different mutations may require distinct therapeutic approaches based on their specific functional effects. For instance, variants with dominant-negative effects might benefit from suppression of the mutant allele, while those causing complete loss-of-function might require gene replacement or downstream modulation of neuronal excitability .

How do interactions between Kcnc1 and other cellular components contribute to channel function and neuronal excitability?

Beyond its primary role as an ion channel, Kcnc1 functions within a complex network of protein-protein interactions that modulate neuronal function:

  • Heteromeric channel assembly:

    • Kcnc1 can form heterotetrameric channels with other Kv3 family members, particularly KCNC2 (Kv3.2)

    • The composition of these heteromers influences channel properties and neuronal firing characteristics

  • Regulatory protein interactions:

    • Ancillary subunits like KCNE1, KCNE2, or KCNE3 can modulate channel properties

    • Nitric oxide (NO) can indirectly regulate channel function through cGMP- and PKG-mediated signaling cascades

  • Cytoskeletal interactions:

    • Research on related potassium channels (Kcnb1) indicates important interactions with the actin cytoskeleton

    • These interactions can affect channel trafficking, localization, and function independent of the channel's conductive properties

    • Similar mechanisms may apply to Kcnc1, particularly in neurodevelopmental contexts

  • Integrin signaling pathways:

    • Potassium channels can form complexes with integrins (Integrin_K+ Channel_Complexes or IKCs)

    • These complexes may influence neuronal migration, connectivity, and network development

    • Disruption of these interactions could contribute to neurodevelopmental aspects of Kcnc1-related disorders

Understanding these complex interactions provides new perspectives on how Kcnc1 mutations might disrupt neuronal function beyond simple changes in potassium conductance, potentially revealing novel therapeutic targets.

What quality control measures are essential when working with recombinant mouse Kcnc1 proteins?

When working with recombinant mouse Kcnc1, researchers should implement the following quality control measures:

  • Purity assessment:

    • SDS-PAGE analysis should confirm ≥85% purity

    • Western blot verification with specific antibodies (e.g., those recognizing amino acids 254-299 of Kv3.1)

  • Functional validation:

    • Electrophysiological confirmation of proper channel function

    • Verification of characteristic biophysical properties (activation threshold, kinetics)

  • Storage and handling:

    • Store at -20°C for extended storage

    • For working solutions, store at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles that can compromise protein integrity

    • Maintain in appropriate buffer conditions, typically including glycerol as a stabilizer

  • Expression system considerations:

    • Validate that the expression system provides proper post-translational modifications

    • For functional studies, confirm membrane targeting and assembly into tetramers

    • Consider native versus tagged versions depending on experimental goals

How can researchers effectively model and analyze the complex electrophysiological effects of Kcnc1 mutations?

Effectively modeling Kcnc1 mutation effects requires sophisticated analytical approaches:

  • Heterologous expression systems:

    • Utilize expression systems that accurately recapitulate neuronal membrane properties

    • For heterozygous mutations, co-express wild-type and mutant channels in appropriate ratios (typically 1:1)

    • Consider tri-heteromeric channels when studying interactions with other Kv3 family members

  • Comprehensive electrophysiological protocols:

    • Assess multiple parameters beyond simple current amplitude:

      • Voltage-dependence of activation and inactivation

      • Activation and deactivation kinetics

      • Frequency-dependent properties

      • Response to repetitive stimulation

  • Computational modeling:

    • Incorporate channel properties into neuronal models

    • Simulate effects on action potential waveform, firing frequency, and network activity

    • Compare model predictions with experimental observations

  • Statistical approaches for data analysis:

    • Use appropriate statistical methods for electrophysiological data

    • Account for cell-to-cell variability

    • Consider paired analyses when comparing wild-type and mutant channels in the same cell

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.