Recombinant Mouse Potassium voltage-gated channel subfamily C member 2 (Kcnc2)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mouse Potassium Voltage-Gated Channel Subfamily C Member 2 (Kcnc2)

Recombinant Mouse Kcnc2 (Kv3.2) is a genetically engineered protein produced to study the structure and function of voltage-gated potassium channels. This protein is a member of the Shaw-related subfamily (Kv3) and plays a critical role in regulating neuronal excitability by mediating rapid action potential repolarization in high-frequency firing neurons, such as GABAergic interneurons and retinal ganglion cells . The recombinant form retains the functional properties of the native channel, enabling researchers to investigate its biophysical characteristics, pharmacological sensitivities, and roles in disease mechanisms .

Functional Characteristics

Recombinant Kcnc2 channels exhibit delayed rectifier potassium currents with rapid activation at high voltages and slow inactivation . Key functional properties include:

  • Voltage Sensitivity: Activates at membrane potentials above -10 mV .

  • Pharmacology: Highly sensitive to tetraethylammonium (TEA) and 4-aminopyridine (4-AP) (IC₅₀ ≈ 0.1 mM) .

  • Modulation: Channel kinetics are influenced by ancillary subunits (e.g., KCNE1–3) and nitric oxide signaling .

These properties enable sustained high-frequency firing in neurons, a feature critical for synaptic fidelity and gamma oscillation synchronization .

Applications in Research

Recombinant Kcnc2 is widely used in electrophysiological, biochemical, and disease-modeling studies:

ApplicationUse Case
ElectrophysiologyCharacterizing ion channel kinetics and pharmacology
Protein Interaction StudiesInvestigating binding partners like KCNC1/KCNC3 for heteromeric channels
Disease ModelingStudying epilepsy, developmental disorders, and metabolic syndromes
Drug DevelopmentScreening potassium channel modulators for neurological therapies

For example, a de novo KCNC2 variant (p.Cys125Tyr) linked to developmental epileptic encephalopathy was analyzed using recombinant channels, revealing hyperpolarizing shifts in activation thresholds .

Neurological Disorders

  • Epilepsy: Dysfunctional Kv3.2 channels impair fast-spiking interneuron excitability, leading to cortical circuit instability .

  • Developmental Delays: Variants in KCNC2 disrupt GABAergic transmission, contributing to encephalopathies .

Metabolic Regulation

  • Type 2 Diabetes: Reduced KCNC2 expression in adipose tissue correlates with hepatic gluconeogenesis and endoplasmic reticulum stress in obesity-mediated diabetes .

Alcohol Use Disorders

  • Pharmacogenetics: Kcnc2 transcript levels in the prefrontal cortex inversely correlate with ethanol consumption in mouse models, suggesting Kv3.2 as a therapeutic target .

Validation and Quality Control

The recombinant protein is validated through:

  • SDS-PAGE/Western Blot: Confirms molecular weight and purity .

  • Analytical SEC: Ensures proper tetrameric assembly .

  • Functional Assays: Voltage-clamp recordings verify channel activity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
Kcnc2; Potassium voltage-gated channel subfamily C member 2; Shaw-like potassium channel; Voltage-gated potassium channel Kv3.2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-642
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Kcnc2
Target Protein Sequence
MGKIESNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPQGDCLTAAGDKLQPLPPP LSPPPRPPPLSPVPSGCFEGGAGNCSSHGGNGGNGGSDHPGGGREFFFDRHPGVFAYVLN YYRTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIG GDPGDDEDLAAKRLGIEDAAGLGGPDGKSGRWRKLQPRMWALFEDPYSSRAARFIAFASL FFILVSITTFCLETHEAFNIVKNKTEPVINGTSPVLQYEIETDPALTYVEGVCVVWFTFE FLVRIVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRIL RIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSAS EHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNF GMYYSLAMAKQKLPRKRKKHIPPAPLASSPTFCKTELNMACNSTQSDTCLGKENRLLEHN RSVLSGDDSTGSEPPLSPPERLPIRRSSTRDKNRRGETCFLLTTGDYTCASDGGIRKGYE KSRSLNNIAGLAGNALRLSPVTSPYNSPCPLRRSRSPIPSIL
Uniprot No.

Target Background

Function
Voltage-gated potassium channel responsible for potassium transport across excitable membranes, primarily in the brain. It plays a crucial role in regulating fast action potential repolarization and sustaining high-frequency firing in central nervous system neurons. As a homotetramer, it forms channels that mediate delayed-rectifier voltage-dependent potassium currents, characterized by rapid activation at high-threshold voltages and slow inactivation. These channels facilitate potassium ion passage down their electrochemical gradient, transitioning between open and closed conformations in response to membrane voltage changes. The channel can assemble into functional homotetrameric and heterotetrameric complexes, incorporating varying proportions of KCNC1, and possibly other family members, influencing channel properties based on the specific alpha subunit composition. Channel properties can be modulated by association with auxiliary subunits, such as KCNE1, KCNE2, and KCNE3, or indirectly by nitric oxide (NO) via a cGMP- and PKG-mediated signaling pathway, resulting in slower activation and deactivation of delayed rectifier potassium channels. This channel contributes to sustained trains of brief action potentials at high frequency in thalamocortical and suprachiasmatic nucleus (SCN) neurons, hippocampal and neocortical interneurons, and retinal ganglion cells. Histamine H2 receptor activation negatively modulates sustained maximal action potential firing frequency in inhibitory hippocampal interneurons through a cAMP- and protein kinase (PKA) phosphorylation-dependent mechanism. It ensures fidelity of synaptic transmission in neocortical GABAergic interneurons by generating action potential (AP) repolarization at nerve terminals, thereby reducing spike-evoked calcium influx and GABA neurotransmitter release. This channel is essential for long-range synchronization of gamma oscillations in the neocortex. It contributes to light-dependent modulation of the circadian rhythm of spontaneous action potential firing in suprachiasmatic nucleus (SCN) neurons.
Gene References Into Functions
  1. While all Kv3 transcripts were significantly expressed in embryonic whole brain extracts, only Kv3.1, Kv3.2, and Kv3.4 subunit proteins were detected, suggesting a novel role for Kv3 channels during this developmental stage. PMID: 21912965
  2. Mice lacking both Kcnc1 and Kcnc2 genes fail to express Kv3.1 and Kv3.2 channels in the suprachiasmatic nucleus. PMID: 21414897
  3. Developmental expression of potassium-channel subunit Kv3.2 within subpopulations of mouse hippocampal inhibitory interneurons. PMID: 12000114
  4. Starburst amacrine cells exhibit large outward currents, partially mediated by the Kv3.2 channel. PMID: 15317859
  5. Kv3.2 expression became detectable in the lumbar cord from postnatal day 12 and increased steadily until reaching adult levels at postnatal day 28. Unlike Kv3.1b, Kv3.2 was not expressed in Renshaw cells. PMID: 16460880
  6. Kv3.2, Kv1, SK potassium, and N-type calcium channels play a significant role in regulating thalamic relay neuron sensory transmission, each channel subtype controlling a distinct stimulus-response curve property. PMID: 17761775

Show More

Hide All

Database Links
Protein Families
Potassium channel family, C (Shaw) (TC 1.A.1.2) subfamily, Kv3.2/KCNC2 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein. Perikaryon. Cell projection, axon. Cell projection, dendrite. Cell junction, synapse, postsynaptic cell membrane. Cell junction, synapse, presynaptic cell membrane. Cell junction, synapse, synaptosome. Cell junction, synapse. Apical cell membrane. Basolateral cell membrane.
Tissue Specificity
Weakly expressed in the brain at postnatal age day 7 (P7) and increased at P60. Not detectable in newborn hippocampus. Expressed weakly at P7 in the early developing hippocampus, increasing progressively and reaching a plateau of expression at P14 that is

Q&A

What is the molecular structure and function of KCNC2?

KCNC2 encodes Kv3.2, a member of the Shaw-related (Kv3) voltage-gated potassium channel subfamily. The protein contains cytosolic N- and C-termini and six membrane-spanning segments that form an ion-selective pore . Structurally, critical regions include the S5-S6 linker that forms part of the ion-selective macromolecular protein pore, the BTB/POZ domain near the N-terminal region involved in tetramerization, and the S6 domain that functions in K+ channel gating . This channel is essential for subserving fast-spiking firing patterns and sustaining trains of action potentials at high frequencies, thereby maintaining effective synaptic transmission and modulating neuronal excitation .

Where is KCNC2 primarily expressed in the mouse brain?

KCNC2 expression is relatively high in the hippocampus, frontal cortex, anterior cingulate cortex, caudate, hypothalamus, basal amygdala, and pituitary . Recent human single-cell transcriptome sequencing (scRNA-seq) studies have demonstrated that KCNC2 is enriched in both inhibitory and excitatory neurons . This expression pattern correlates with its crucial role in regulating neuronal excitability and communication in these brain regions.

How does KCNC2 contribute to normal neurophysiology?

KCNC2 is pivotal to maintaining excitation/inhibition balance in mammalian brains by facilitating fast-spiking GABAergic interneurons to fire action potentials at high frequencies . It plays a key role in optimizing energy efficiency of action potentials . Knockout studies of Kcnc2 in animal models have demonstrated its importance in sustaining trains of action potentials and maintaining effective synaptic transmission .

What types of KCNC2 variants have been identified in neurological disorders?

Multiple pathogenic variants of KCNC2 have been identified in patients with various forms of epilepsy including genetic generalized epilepsy (GGE), developmental and epileptic encephalopathies (DEEs), early-onset absence epilepsy, focal epilepsy, and myoclonic-atonic epilepsy . Recent research has characterized several variants including R405G, T437A, T437N, R351K, V471L, P470S, F382L, and D167Y . These variants are predominantly located in functionally critical regions of the channel including the pore region, selectivity filter, and transmembrane domains.

How do researchers distinguish between pathogenic and benign KCNC2 variants?

Researchers employ multiple criteria to distinguish pathogenic variants:

  • De novo occurrence: Ten of 18 variants in a recent study were confirmed as de novo, strongly supporting pathogenicity .

  • Functional analysis: Electrophysiological studies in expression systems (HEK293 cells or Xenopus oocytes) to determine alterations in channel function .

  • Conservation analysis: Assessment of evolutionary conservation across species and related channel proteins using tools like MEGA7 .

  • Structural modeling: Using tools like AlphaFold to predict how variants might disrupt protein structure and function .

  • Genotype-phenotype correlation: Comparing clinical presentations of patients with the same variant .

What is the genotype-phenotype correlation in KCNC2-related disorders?

VariantPhenotypeEEG FeaturesResponse to TreatmentBrain Imaging
R405GFocal impaired awareness seizure, severe ID, motor developmental disorderGeneralized spike and wave complexesGood response to antiepileptic drugsNo significant brain lesions
V471LInfantile spasms, severe ID-Ineffective medication responseWidespread hypomyelination, hypertrophic frontal lobes, or hydrocephalus
R351KGTCS with myoclonic and complex focal seizuresContinuous spike and wave during slow-wave sleepVariable (one case with intractable seizures, one became seizure-free with VPA)No significant brain lesions
T437NFebrile seizure, myoclonic epilepsyGeneralized EEG featuresPoor response to antiepileptic drugsNo significant brain lesions
T437AIntractable early-onset absence epilepsy-Poor responseNo significant brain lesions

This table demonstrates consistent genotype-phenotype associations across multiple unrelated individuals with variants at the same sites (R405, T437, R351, and V471) .

What electrophysiological techniques are most effective for studying KCNC2 function?

Whole-cell patch clamp recordings represent the gold standard for studying KCNC2 function . Key methodological considerations include:

  • Expression systems: HEK293 cells transfected with EGFP-fusion expression vectors containing wild-type or variant KCNC2 cDNA are commonly used . Xenopus laevis oocytes provide an alternative expression system .

  • Measurement parameters:

    • Current-voltage relationships (I-V curves) with voltages ranging from -40 to +60 mV

    • Normalized current densities (typically at +60 mV)

    • Conductance-voltage (G-V) curves to determine V1/2 (half-maximal activation voltage)

    • Channel activation and deactivation kinetics

  • Data analysis: Comparing variant channels to wild-type controls to determine if variants cause gain-of-function (increased activity) or loss-of-function (decreased activity) .

For example, in the study of R405G, researchers found that this variant caused significantly higher density current at voltages between -40 and +10 mV, and the conductance-voltage curve shifted to the left, indicating a gain-of-function effect compared to wild-type channels .

How can computational modeling enhance KCNC2 functional studies?

Computational modeling complements experimental approaches for studying KCNC2 variants . Key applications include:

  • Structural modeling: Since high-resolution structures of KCNC2 channels are unavailable, tools like AlphaFold help predict how variants affect protein structure. For R405G, modeling revealed disruption of hydrogen bonds with Y401, F421, and K422, destabilizing the channel structure .

  • Simulation of neuronal activity: Computational models of GABAergic interneurons can translate channel-level defects to network-level consequences. Simulations showed that variants like P470S, F382L, and V471L decreased neuronal firing frequency, resulting in disinhibition of neural networks .

  • Prediction of pharmacological responses: Models can predict how variants might respond to different channel modulators, potentially informing personalized treatment approaches.

What are the critical quality control measures for recombinant KCNC2 production?

When producing recombinant mouse KCNC2 for functional studies, researchers should implement these quality control measures:

  • Sequence verification: Confirm the integrity of the KCNC2 cDNA sequence through Sanger sequencing before and after mutagenesis .

  • Expression validation:

    • Western blotting to confirm protein expression and molecular weight

    • Fluorescence microscopy of EGFP-tagged constructs to verify appropriate cellular localization

    • Baseline electrophysiological recordings to confirm functional expression

  • Functional benchmarking: Compare key electrophysiological parameters of wild-type channels with published values to ensure consistency across studies.

  • Controls for expression system effects: Include empty vector controls and account for endogenous currents in the expression system.

How do gain-of-function versus loss-of-function KCNC2 variants differ experimentally?

Gain-of-function and loss-of-function KCNC2 variants display distinct electrophysiological signatures:

ParameterGain-of-Function VariantsLoss-of-Function Variants
Activation thresholdNegative shift in voltage dependencePositive shift in voltage dependence
Current densityIncreased at hyperpolarized potentialsDecreased across voltage range
Channel kineticsVariable effects on activation/deactivationOften slowed activation/deactivation
Clinical phenotypeTypically severe DEEOften milder phenotypes (GGE)
ExamplesR405GSome GGE-associated variants

Functional analysis of four variants demonstrated gain of function in three severely affected DEE cases and loss of function in one case with a milder phenotype (GGE) . Some variants (P470S, F382L, V471L) show complex effects including decreased activation and deactivation kinetics combined with increased conductance and negative shifts in activation threshold .

What methodological approaches can resolve contradictory findings in KCNC2 research?

When facing contradictory findings, researchers should consider:

  • Expression system differences: Results may vary between HEK293 cells and Xenopus oocytes due to differences in membrane composition, post-translational modifications, and trafficking machinery.

  • Recording conditions: Standardize temperature, ionic compositions, and voltage protocols across experiments.

  • Data normalization: Ensure appropriate normalization of current densities to cell capacitance to account for variable cell sizes.

  • Comprehensive parameter assessment: Evaluate multiple channel parameters (activation, deactivation, inactivation, recovery from inactivation) rather than focusing on single metrics.

  • Computational validation: Use neuronal simulations to determine whether seemingly contradictory channel-level findings might converge at the network level.

How can researchers design experiments to test KCNC2 interactions with modulatory proteins?

To study interactions between KCNC2 and regulatory proteins:

  • Co-immunoprecipitation: Express tagged versions of KCNC2 and potential interacting proteins in expression systems, then use antibodies against the tag to pull down protein complexes.

  • FRET (Förster resonance energy transfer): Tag KCNC2 and potential interacting proteins with compatible fluorophores to detect proximity-dependent energy transfer.

  • Electrophysiology with co-expression: Compare KCNC2 function when expressed alone versus co-expressed with regulatory proteins.

  • Domain mapping: Create truncation or chimeric constructs to identify specific regions of KCNC2 involved in protein-protein interactions.

  • Pharmacological manipulation: Use specific activators or inhibitors of signaling pathways to identify regulatory mechanisms affecting KCNC2 function.

What is the therapeutic significance of understanding KCNC2 function?

Understanding KCNC2 function has significant therapeutic implications:

  • Treatment selection: Eight drug-responsive patients became seizure-free using valproic acid as monotherapy or in combination, including severe DEE cases . This suggests that understanding channel dysfunction can guide treatment selection.

  • Variant-specific approaches:

    • For gain-of-function variants: Channel blockers that reduce KCNC2 activity

    • For loss-of-function variants: Channel modulators that enhance function

  • Precision medicine: The consistent genotype-phenotype associations observed for specific variants (R405G, T437A/N, R351K, V471L) could eventually guide personalized treatment protocols .

What are the current limitations in translating KCNC2 research to clinical applications?

Several challenges exist in translating KCNC2 research to clinical applications:

  • Structural understanding: High-resolution structures of KCNC2 channels are still unavailable, limiting structure-based drug design approaches .

  • Limited clinical data: The "scarcity of reported cases" makes it difficult to establish robust treatment guidelines .

  • Heterogeneous mechanisms: Both gain-of-function and loss-of-function variants can cause epilepsy, complicating therapeutic approaches.

  • Non-selective pharmacology: Current potassium channel modulators lack specificity for KCNC2 over other related channels.

  • Developmental considerations: KCNC2 dysfunction during critical developmental periods may cause irreversible changes that cannot be targeted with post-diagnostic interventions.

What emerging technologies might advance KCNC2 research?

Several emerging technologies could significantly advance KCNC2 research:

  • CryoEM for structural determination: Could provide high-resolution structures of KCNC2 in different conformational states.

  • Patient-derived models:

    • iPSC-derived neurons from patients with KCNC2 variants

    • Brain organoids to study developmental effects of KCNC2 dysfunction

  • In vivo electrophysiology: Targeted recordings from specific neuronal populations expressing KCNC2 in animal models.

  • Gene therapy approaches: Development of strategies to correct or compensate for KCNC2 variants through viral delivery of functional channels or regulators.

  • Network analysis: Advanced imaging and electrophysiological techniques to understand how KCNC2 dysfunction affects neural circuit development and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.