Recombinant Mouse Potassium voltage-gated channel subfamily C member 4 (Kcnc4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse KCNC4

Recombinant Mouse Potassium voltage-gated channel subfamily C member 4 (Kcnc4) is a genetically engineered protein corresponding to the murine ortholog of the human KCNC4 gene. This voltage-gated potassium channel belongs to the Kv3 subfamily (Kv3.4) and plays critical roles in neuronal excitability, action potential repolarization, and synaptic transmission. Its recombinant form is widely used in molecular and electrophysiological studies to investigate ion channel functions, disease mechanisms, and therapeutic targets.

Basic Properties of Recombinant Kcnc4

PropertyDescriptionSource
Gene NameKcnc4 (Mouse)
Protein NamePotassium voltage-gated channel subfamily C member 4 (Kv3.4)
OrganismMus musculus (Mouse)
Transmembrane Segments6 (S1–S6), including a voltage sensor in S4
UniProt IDNot explicitly provided for mouse; human homolog: Q03721
Molecular Weight~64–69 kDa (human isoforms; mouse similar)

Key Functional Roles:

  • Voltage-dependent K⁺ permeability: Regulates neuronal action potential repolarization and synaptic transmission .

  • Phosphorylation-dependent modulation: PKC-mediated phosphorylation at Ser8, Ser9, Ser15, and Ser21 in the N-terminal inactivation domain (NTID) slows inactivation kinetics .

  • Heterotetramer formation: Co-assembles with other Kv3 subunits (e.g., Kv3.1, Kv3.2) to form functional channels .

Production Platforms

Recombinant Kcnc4 is typically produced via heterologous expression systems, such as:

SystemDescriptionSource
Mammalian CellsHEK293 or COS-7 cells for functional channel assembly and post-translational modifications
Bacterial SystemsE. coli for soluble protein production (His-tagged variants)
Viral VectorsAdeno-associated viruses (AAVs) for in vivo expression in neurons

Key Applications:

  1. Electrophysiological Studies:

    • Patch-clamp recordings to analyze current kinetics (activation, inactivation, recovery) .

    • PKC modulation experiments to study phosphorylation effects on channel gating .

  2. Disease Modeling:

    • Investigating Kv3.4's role in neurological disorders (e.g., epilepsy, Alzheimer’s disease) using knockdown/knockout models .

  3. Drug Discovery:

    • Screening Kv3.4 modulators for therapeutic potential in pain management or neurodegenerative diseases .

Role in Neuronal Excitability

Kcnc4 is critical for fast-inactivating A-type potassium currents, which regulate action potential repolarization in nociceptors and spinal neurons. Key findings include:

MechanismExperimental EvidenceSource
PKC-dependent modulationPKC activation eliminates fast inactivation, shortening action potentials in DRG neurons
Synaptic transmissionKv3.4 mediates excitatory synaptic transmission in spinal circuits

Phosphorylation Effects:

  • Wild-type Kv3.4: Rapid inactivation (N-type) due to NTID folding.

  • Phosphomimetic mutants (S8,9,15,21D): Slowed inactivation via NTID disordering, enhancing outward currents .

Disease Associations

DisorderKCNC4 InvolvementSource
Alzheimer’s DiseaseOverexpression in early stages linked to neurodegenerative pathways
CancerAbnormal expression in oral squamous cell carcinomas (human studies)
Pain SensitizationDysregulation implicated in post-spinal cord injury pain

Potential Therapeutic Targets:

  • Kv3.4 blockers: Induce cell cycle arrest in vascular smooth muscle cells (human studies) .

  • PKC modulators: Tune Kv3.4 activity to regulate neuronal excitability .

Limitations of Current Models

  • Species-specific differences: Mouse Kcnc4 may exhibit distinct biophysical properties compared to human Kv3.4 .

  • Post-translational complexity: Recombinant systems may lack endogenous regulatory mechanisms (e.g., palmitoylation) .

Emerging Research Avenues

  1. Cryo-EM studies: Structural elucidation of Kcnc4 in different phosphorylation states.

  2. CRISPR-based editing: Precise manipulation of Kcnc4 in murine models for disease phenotyping.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand your specific requirements. Please indicate your preferred format during order placement, and we will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. If you require dry ice, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Kcnc4; Potassium voltage-gated channel subfamily C member 4; Voltage-gated potassium channel subunit Kv3.4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-628
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Kcnc4
Target Protein Sequence
MISSVCVSSYRGRKSGNKPPSKTCLKEEMAKGEASEKIIINVGGTRHETYRSTLRTLPGT RLAWLADPDGGGRPESDGGGAGSSGSSGGGGGGGGCEFFFDRHPGVFAYVLNYYRTGKLH CPADVCGPLFEEELTFWGIDETDVEPCCWMTYRQHRDAEEALDIFESPDGGGGGAGPGDE AGDDERELALQRLGPHEGGSGPGAGSGGCRGWQPRMWALFEDPYSSRAARVVAFASLFFI LVSITTFCLETHEAFNIDRNVTEIHRVGNITSVRFRREVETEPILTYIEGVCVMWFTLEF LVRIVCCPDTLDFVKNLLNIIDFVAILPFYLEVGLSGLSSKAARDVLGFLRVVRFVRILR IFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGARPSDPRGND HTDFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFG MYYSLAMAKQKLPKKRKKHVPRPPQLESPIYCKSEETSPRDSTYSDTSPPAREEGVVERK RADSKQNGDANAVLSDEEGAGLTQPLALAPTPEERRALRRSGTRDRNKKAAACFLLSAGD YACADGSVRKEGNVEPKACVPVSHTCAL
Uniprot No.

Target Background

Function
This protein plays a crucial role in mediating the voltage-dependent potassium ion permeability of excitable membranes. It exists in either an open or closed conformation in response to voltage differences across the membrane, forming a potassium-selective channel. This allows potassium ions to pass through according to their electrochemical gradient.
Gene References Into Functions
  1. Kv3 channels, responsible for driving AP repolarization, experience rapid inactivation upon incorporation of Kv3.4 subunits. PMID: 28228266
  2. KV3.4 channel subunits show precocious upregulation in cultured astrocytes exposed to Ab oligomers. PMID: 28390823
  3. While all Kv3 transcripts are significantly expressed in embryonic age in whole brain extracts, only Kv3.1, Kv3.2 and Kv3.4 subunit proteins are present, suggesting a novel role for Kv3 channels at this developmental stage. PMID: 21912965
Database Links
Protein Families
Potassium channel family, C (Shaw) (TC 1.A.1.2) subfamily, Kv3.4/KCNC4 sub-subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Kcnc4 and what is its molecular structure?

Kcnc4 (Kv3.4) is an integral membrane protein belonging to the Kv3 subfamily of voltage-gated potassium channels. The protein consists of 635 amino acid residues and contains six transmembrane segments (S1-S6) with a voltage-sensor domain located in the S4 segment . The channel forms either homotetrameric potassium channels (composed of four identical Kcnc4 subunits) or heterotetrameric channels (containing different Kv3 subfamily members) . The channel's structure enables its primary function: the regulation of potassium ion transport across the cell membrane in response to voltage changes.

Unlike other Kv3 subfamily members that regulate slow-inactivating delayed rectifier-type currents, Kcnc4 is involved in the production of fast-inactivating A-type currents . This functional distinction is critical for its physiological roles.

What are the primary tissue expression patterns of mouse Kcnc4?

Mouse Kcnc4 is primarily expressed in the brain and kidney . Within the nervous system, it shows significant expression in dorsal root ganglion (DRG) neurons, where it regulates action potential repolarization and influences nociceptive signaling . The channel also plays roles in excitatory synaptic transmission in the spinal cord .

How does Kcnc4 function in normal physiology?

Kcnc4 functions as a voltage-gated potassium channel that regulates the transportation of potassium ions across the membrane according to their electrochemical gradient . The channel changes its conformation between open and closed states in response to membrane voltage differences, thereby controlling potassium ion permeability in excitable membranes .

In skeletal muscle, Kcnc4-containing channels regulate the resting potential of muscle cells . In neurons, particularly nociceptors, Kcnc4 governs action potential repolarization, influencing the duration and frequency of action potentials . This function is critical for proper neuronal signaling and synaptic transmission.

What viral vector approaches are effective for Kcnc4 manipulation in research?

For manipulation of Kcnc4 expression in research settings, Adeno-Associated Virus (AAV) vectors have proven highly effective. Commercially available mouse Kcnc4 AAV particles, such as serotype AAV-2 with Myc-DDK tags, provide researchers with validated tools for overexpression studies . These vectors typically achieve viral titers of approximately 10^13 TU/mL, ensuring efficient transduction of target cells .

For experimental design, researchers should consider:

  • Promoter selection: The human synapsin (hSyn) promoter drives neuron-specific expression and is commonly used for Kcnc4 studies in the nervous system

  • Reporter co-expression: Vectors incorporating IRES elements enable bicistronic expression of Kcnc4 and reporters like GFP, facilitating identification of transduced cells

  • Transduction efficiency: For DRG neurons, AAV6 serotype has demonstrated effective transduction, with expression detectable 6 days post-infection

When evaluating transduction success, a combination of fluorescence microscopy (for reporter expression) and patch clamp electrophysiology (for functional validation) provides complementary information about both expression and channel function .

How can researchers generate and utilize Kcnc4 mutants to study channel function?

Several functionally distinct Kcnc4 mutants have been developed to investigate specific aspects of channel function:

Mutant TypeSpecific MutationsFunctional ImpactResearch Applications
Wild-type (WT)NoneFast transient currents with normal inactivationReference standard; overexpression studies
Phosphonull (PN)S8A, S9A, S15A, S21AFast transient currents similar to WTStudy phosphorylation-independent properties
Phosphomimic (PM)S8D, S9D, S15D, S21DCurrents with impaired inactivationInvestigate consequences of constitutive phosphorylation
Dominant-negative (DN)W429FAbolishes endogenous Kv3.4 currentFunctional knockdown studies

These mutants can be generated using QuikChange mutagenesis based on the rat Kcnc4 (rKv3.4) wild-type sequence and subsequently packaged into AAV vectors . When expressed in neurons, they differentially affect action potential (AP) properties: Kv3.4-DN produces the longest AP duration, Kv3.4-PM generates the shortest, while Kv3.4-WT and Kv3.4-PN yield intermediate durations .

For patch-clamp electrophysiology experiments, these mutants exhibit similar voltage dependence of activation but differ in their inactivation kinetics, making them valuable tools for investigating how specific channel properties influence neuronal excitability .

What is the role of phosphorylation in Kcnc4 function and how can it be studied?

Kcnc4 function is significantly modulated by protein kinase C (PKC)-mediated phosphorylation, particularly at four key serine residues (S8, S9, S15, S21) in the N-terminal inactivation domain (NTID) . This phosphorylation dramatically alters channel inactivation properties and consequently affects action potential repolarization in neurons.

To study phosphorylation effects, researchers can:

  • Utilize phosphomimic (PM) mutants (S8D, S9D, S15D, S21D) that substitute serine residues with negatively charged aspartic acid, mimicking the phosphorylated state

  • Compare with phosphonull (PN) mutants (S8A, S9A, S15A, S21A) where serines are replaced with non-phosphorylatable alanines

  • Conduct voltage-clamp and current-clamp analyses to correlate phosphorylation state with channel kinetics and action potential properties

These approaches have revealed that PKC phosphorylation creates a tunable mechanism for regulating action potential repolarization rates and durations in dorsal root ganglion neurons, with significant implications for neuronal signaling .

How is Kcnc4 implicated in cancer pathophysiology?

Abnormal expression of Kcnc4 has been implicated in several cancer types, particularly oral and head and neck squamous cell carcinomas . The early occurrence and high prevalence of abnormal Kcnc4 expression in oral leucoplakias support its role in tumorigenesis rather than in tumor progression or disease outcome .

Research methodologies for investigating Kcnc4 in cancer include:

  • Expression analysis in pre-cancerous and cancerous tissues compared to normal controls

  • Correlation of expression levels with clinical staging and patient outcomes

  • Functional studies examining how Kcnc4 modulation affects cancer cell proliferation, apoptosis, and cell cycle progression

Studies have shown that Kcnc4 plays a role in malignant transformation, suggesting it could serve as a biomarker for cancer risk assessment . Additionally, research indicates that Kcnc4 electrosignaling may regulate cell cycle and survival in irradiated leukemia cells, and Kcnc4 blockade can induce cell cycle arrest after G2/M phase completion in vascular smooth muscle cells .

What is known about Kcnc4's role in neurological disorders?

Kcnc4 has been implicated in several neurological conditions:

  • Alzheimer's Disease: Kcnc4 overexpression is observed in both early and advanced stages of Alzheimer's disease . This altered expression may contribute to neuronal dysfunction and apoptotic processes.

  • Neuropathic Pain: Kcnc4 channel dysregulation has been identified as a peripheral mechanism of pain sensitization following spinal cord injury (SCI) . Research suggests that Kcnc4-based therapeutic interventions may have potential for treating post-SCI pain.

For studying Kcnc4 in neurological disorders, researchers commonly employ:

  • Animal models with altered Kcnc4 expression or function

  • Electrophysiological recordings to assess channel activity in disease states

  • Pharmacological interventions targeting Kcnc4 to evaluate therapeutic potential

  • Histological and molecular analyses of Kcnc4 expression patterns in affected tissues

What are the key considerations for patch-clamp studies of recombinant Kcnc4?

When conducting patch-clamp electrophysiology studies with recombinant mouse Kcnc4, researchers should consider:

  • Expression System Selection:

    • Primary neuronal cultures (particularly DRG neurons) provide a physiologically relevant background

    • Duration of expression: For AAV-mediated expression in DRG neurons, reliable expression and function are typically observed 6-9 days post-infection

  • Electrophysiological Parameters:

    • Voltage-clamp protocols should assess activation, inactivation, and recovery from inactivation

    • Current-clamp recordings should evaluate effects on action potential waveforms, particularly repolarization phase

    • Temperature control is critical as channel kinetics are temperature-dependent

  • Analysis Approaches:

    • Quantify both current amplitude and kinetic parameters (activation time constants, inactivation rates)

    • For action potentials, measure duration at half-maximal amplitude, repolarization rate, and afterhyperpolarization

  • Controls:

    • GFP-only expression vectors serve as important controls for viral transduction effects

    • Non-transduced neurons provide baseline comparisons for endogenous channel activity

How can researchers optimize recombinant Kcnc4 protein production for structural and functional studies?

For production of soluble and functional Kcnc4 protein:

  • Expression System Considerations:

    • Mammalian expression systems often yield properly folded and post-translationally modified channels

    • Insect cell systems may provide higher yields while maintaining functional properties

    • Cell-free systems can be employed for rapid screening of mutants

  • Purification Strategies:

    • Affinity tags such as Myc-DDK (available in commercial constructs) facilitate purification

    • Detergent selection is critical for maintaining channel structure and function during solubilization

    • Size exclusion chromatography can help isolate tetrameric channel complexes

  • Functional Verification:

    • Reconstitution into lipid bilayers or liposomes for electrophysiological characterization

    • Binding assays with known channel blockers to confirm proper folding

    • Structural analysis through techniques such as cryo-electron microscopy

Commercial platforms like the MagicTM membrane protein production platform offer versatile options for obtaining soluble and functional target proteins for various research applications .

What emerging technologies show promise for advancing Kcnc4 research?

Several cutting-edge approaches hold potential for advancing our understanding of Kcnc4 function:

  • CRISPR/Cas9 Gene Editing:

    • Generation of cell lines and animal models with precisely engineered mutations

    • Knockin of fluorescent tags for live imaging of channel trafficking and localization

    • Creation of conditional knockout models for tissue-specific studies

  • Optogenetic and Chemogenetic Approaches:

    • Development of light-sensitive or ligand-sensitive Kcnc4 variants for acute modulation

    • Combination with electrophysiology for real-time correlation of channel activity with neuronal function

  • Computational Modeling:

    • Molecular dynamics simulations to understand structural determinants of channel gating

    • Integration of channel properties into neuronal network models to predict system-level effects

  • High-Throughput Screening:

    • Development of assays suitable for identifying novel Kcnc4 modulators

    • Phenotypic screening in disease models to identify therapeutic candidates

These emerging approaches, combined with established methodologies, will likely yield significant insights into Kcnc4 function in health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.