Recombinant Mouse Potassium voltage-gated channel subfamily E member 1 (Kcne1)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Channel Modulation

KCNE1 regulates multiple K⁺ channels through distinct mechanisms:

KCNQ1-KCNE1 Complex (I<sub>Ks</sub>)

  • Slow Activation: KCNE1’s TMD restricts KCNQ1’s S4-S5 linker movement, delaying activation .

  • Increased Conductance: Stabilizes the open state, eliminating inactivation and boosting current magnitude .

  • Voltage Dependence: Right-shifts activation voltage (V<sub>0.5</sub>), slowing repolarization in cardiac myocytes .

KCNH2-KCNE1 Complex (I<sub>Kr</sub>)

  • Modulates hERG Currents: Wild-type KCNE1 enhances hERG amplitude but suppresses it in mutants like A8V or D85N, linked to long QT syndrome (LQTS) .

  • Drug Sensitivity: KCNE1 variants alter hERG’s response to cisapride and clarithromycin but not quinidine .

Table 2: Functional Effects of KCNE1 on K⁺ Channels

ChannelKCNE1 EffectDisease LinkSource
KCNQ1Slows activation, increases conductanceLQTS, Jervell-Lange-Nielsen
KCNH2 (hERG)Modulates current amplitude; mutations suppress I<sub>Kr</sub>LQTS

Disease-Associated Mutations

KCNE1 mutations disrupt channel function, leading to arrhythmias and hearing loss:

  • S74L/D76N (LQTS5): Impairs KCNQ1-KCNE1 assembly, reducing I<sub>Ks</sub> and prolonging QT intervals .

  • D85N Polymorphism: Suppresses hERG currents, increasing drug-induced LQTS risk .

  • A8V Mutation: Abolishes hERG modulation, causing severe QT prolongation and deafness .

Table 3: KCNE1 Mutations and Phenotypes

MutationEffect on Channel FunctionAssociated ConditionSource
D76NReduces KCNQ1-KCNE1 current; disrupts hERG modulationLQTS5
D85NSuppresses hERG amplitudeDrug-induced LQTS
A8VEliminates hERG modulationSevere LQTS + deafness

Mouse Models

  • Punk Rocker (Kcne1<sup>pkr</sup>): A spontaneous C→T mutation truncating KCNE1 at residue 67, causing deafness, ataxia, and LQTS-like phenotypes. Mimics human Jervell-Lange-Nielsen syndrome .

  • Kcne1 Knockout: Lethal, with no I<sub>Ks</sub> currents, highlighting KCNE1’s indispensability in cardiac repolarization .

Trafficking and Regulation

  • SGK1 Phosphorylation: Enhances KCNQ1-KCNE1 membrane insertion via PIKfyve-dependent trafficking, increasing I<sub>Ks</sub> density .

  • C-Terminus Interactions: D76 in KCNE1 binds KCNQ1’s C-terminal domain, critical for channel stability .

Research Applications

KCNE1 is pivotal in studying:

  • Cardiac Repolarization: I<sub>Ks</sub> dysfunction mechanisms in LQTS.

  • Hearing Loss: KCNQ1-KCNE1’s role in K⁺ secretion in the cochlea .

  • Drug Interactions: Modulation of hERG by KCNE1 variants in arrhythmia risk assessment .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, serving as a reference point.
Shelf Life
Shelf life is influenced by factors such as storage state, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag.
Synonyms
Kcne1; Potassium voltage-gated channel subfamily E member 1; Delayed rectifier potassium channel subunit IsK; mISK; IKs producing slow voltage-gated potassium channel subunit beta Mink; Minimal potassium channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Kcne1
Target Protein Sequence
MSLPNSTTVLPFLARLWQETAEQGGNVSGLARKSQLRDDSKLEALYILMVLGFFGFFTLGIMLSYIRSKKLEHSHDPFNVYIESDAWQEKGKAVFQARVLESFRACYVIENQAAVEQPATHLPELKPLS
Uniprot No.

Target Background

Function
KCNE1 is an auxiliary protein that assembles as a beta subunit with a voltage-gated potassium channel complex composed of pore-forming alpha subunits. It plays a role in modulating the gating kinetics and enhancing the stability of the channel complex. When assembled with KCNB1, KCNE1 modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1. In association with KCNQ1/KVLQT1, it is proposed to form the slowly activating delayed rectifier cardiac potassium (IKs) channel. The outward current reaches its steady state only after 50 seconds. When assembled with KCNH2/HERG, KCNE1 may modulate the rapidly activating component of the delayed rectifying potassium current in the heart (IKr).
Gene References Into Functions
  1. SUMOylation of KCNQ1 is KCNE1 dependent and determines the native attributes of cardiac IKs in vivo. PMID: 28743749
  2. The electrophysiological effects of BACE1 on KCNQ1 reported here were independent of its enzymatic activity. PMID: 26454161
  3. KCNE1 and KCNE3: The yin and yang of voltage-gated K(+) channel regulation PMID: 26410412
  4. KCNE1 and KCNE2, auxiliary subunits of voltage-gated potassium channels, undergo sequential cleavage mediated by either alpha-secretase and presenilin(PS)/gamma-secretase or BACE1 and PS/gamma-secretase in cells. PMID: 23504710
  5. In clearance studies the KCNE1 knockout mice had an increased fractional excretion of Na+, Cl-, HCO3(-) and water. PMID: 21576273
  6. This study confirmed that KCNE1 channels are necessary for K+ secretion in developmental Saccule and Utricle in mice. PMID: 22090480
  7. Beta-adrenergic receptor-regulated I Ks channels can play a role in atrial fibrillation. PMID: 18006587
  8. both the voltage-dependence and kinetics of gating were found to depend on the relative densities of KCNQ1 and KCNE1, suggesting the heart rhythm may be regulated by the relative expression of the auxiliary subunit PMID: 20962273
  9. Findings directly implicate triggered electrical activity and spatial and temporal re-entrant mechanisms in the arrhythmogenesis observed in KCNE1 (-/-) hearts. PMID: 19430811
  10. intestinal Cl(-) secretion is independent from KCNE1 but requires KCNQ1 and in mouse pancreatic acini KCNQ1 probably co-assembled with KCNE1 leads to a voltage-dependent K(+) current that might be of importance for electrolyte and enzyme secretion. PMID: 11889581
  11. the spatial expression of minK-lacZ in the adult mouse heart has been shown, for the larger part, to be coincident with the conduction tissues PMID: 12741710
  12. The transitory transfection of kcne1 restores both Cl- and K+ swelling-activated currents, confirming the implication of KCNE1 protein in the cell-volume regulation in PCT cells in primary cultures. PMID: 12962276
  13. KCNE1 is associated with an arrhythmogenic phenotype that shows an increased dispersion of conduction velocities PMID: 14561835
  14. The HCO3- dependent regulatory volume decrease in isolated renal proximal tubule cells requires normal expression of KCNE1. PMID: 15123546
  15. analysis of the IsK/KvLQT1 potassium channel in a new corticosteroid-sensitive cell line derived from the inner ear PMID: 16478723
  16. Our findings suggest an important role for LIMP2 in the control of the localization and the level of apically expressed membrane proteins such as KCNQ1, KCNE1 and megalin in the stria vascularis. PMID: 16901941
  17. In juvenile mice, the KCNE1 mutation was associated with a strong decrease in the expression of the calcium-binding proteins calbindin, calretinin and parvalbumin within the medial vestibular nucleus PMID: 17627998
  18. these data indicate that KCNE1 and KCNE3 interact directly with Kv12.2 channels to regulate channel membrane trafficking PMID: 19623261

Show More

Hide All

Database Links
Protein Families
Potassium channel KCNE family
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Apical cell membrane. Membrane raft.
Tissue Specificity
Restrictively localized in the apical membrane portion of epithelial cells.

Q&A

What is the structural organization of KCNE1 and how does it interact with KCNQ1?

KCNE1 consists of a curved α-helical transmembrane domain (TMD) flanked by intra- and extracellular domains that are also comprised of α-helices joined by flexible linkers. The KCNE1 TMD interacts with KCNQ1 in specific ways depending on the channel state. In the closed state, KCNE1 sits on and restricts the movement of the S4-S5 linker that connects the voltage sensor to the pore domain of KCNQ1, creating an adhesive interaction that must be disrupted before the channel can open in response to membrane depolarization. In the open state, the extracellular end of the KCNE1 TMD forms an interface with an intersubunit cleft in KCNQ1 associated with most known gain-of-function disease mutations .

How does KCNE1 physiologically modulate KCNQ1 channel function?

KCNE1 modulates KCNQ1 through two primary mechanisms: (1) it slows channel activation kinetics and (2) it enhances channel conductance. Together, these modifications generate the slow delayed rectifier current (IKs) that is critical for the repolarization phase of the cardiac action potential. This modulation is essential for normal cardiac function and hearing. The interaction creates an adhesive connection with the S4-S5 linker of KCNQ1 that must be overcome during depolarization, explaining the slowed activation. When bound to the "gain-of-function cleft" in the open state, KCNE1 stabilizes the open conformation and increases conductance .

Does KCNE1 interact with potassium channels other than KCNQ1?

Yes, KCNE1 has been demonstrated to modify other potassium channels, most notably the human ether-à-go-go-related gene (hERG) potassium channel, which generates the rapid delayed rectifier current (IKr). Wild-type KCNE1 significantly increases macroscopic hERG current magnitude with only modest alterations to kinetics and without changes to channel unitary conductance or cell surface expression. This suggests that KCNE1 may increase the "active fraction in a membrane pool containing active and dormant channels." This interaction is physiologically relevant as evidenced by antisense oligonucleotide experiments showing decreased IKr when KCNE1 is knocked down in cardiac cells .

What are the recommended approaches for structural determination of KCNE1?

For structural studies of KCNE1, solution NMR spectroscopy has proven effective as demonstrated in previous research. When preparing recombinant KCNE1, expression in bacterial systems followed by purification in detergent micelles or lipid bilayers is recommended. Integrative structural biology methods combining NMR data with computational modeling have been successful in determining KCNE1 structure and its interactions with channel partners. For complex modeling, researchers should employ template-based homology modeling (using structures like Kv1.2 as templates for KCNQ1) combined with Rosetta software to fill in connecting loop structures that cannot be modeled from templates due to poor resolution or sequence gaps .

What experimental systems are most suitable for functional studies of recombinant mouse KCNE1?

For functional studies of mouse KCNE1, heterologous expression systems such as Xenopus oocytes or mammalian cell lines (HEK293, CHO) are most commonly used. Electrophysiological techniques, particularly voltage-clamp and patch-clamp recordings, are essential for assessing channel function. When conducting co-expression studies with channel partners like KCNQ1, careful titration of KCNE1:KCNQ1 expression ratios is critical to ensure physiological relevance. For more native contexts, cardiomyocyte culture systems derived from mouse models or induced pluripotent stem cells can be employed. Action potential clamp techniques can provide particularly valuable insights for comparing wild-type and mutant KCNE1 effects under physiologically relevant conditions, as demonstrated in studies comparing wild-type and A8V KCNE1 effects on hERG currents .

How can researchers effectively introduce and validate KCNE1 mutations for structure-function studies?

For introducing mutations into mouse KCNE1, site-directed mutagenesis using PCR-based methods is the standard approach. When validating mutations, sequencing verification is essential, followed by expression analysis using western blotting or immunofluorescence to confirm proper protein production. Functional validation should include electrophysiological characterization comparing mutant to wild-type KCNE1, assessing parameters such as current density, activation/deactivation kinetics, and voltage dependence. For structure-function studies examining disease-associated mutations, computational modeling informed by experimental restraints can help predict structural perturbations. Additionally, co-immunoprecipitation experiments can assess whether mutations affect physical interactions with channel partners. When studying biallelic mutations, as in Jervell and Lange-Nielsen syndrome cases, it's crucial to examine both homozygous and heterozygous states to fully understand phenotypic implications .

What are the key differences between KCNE1 mutations causing Jervell and Lange-Nielsen syndrome versus Romano-Ward syndrome?

Jervell and Lange-Nielsen syndrome (JLNS2) results from recessive (biallelic) variants in KCNE1, characterized by congenital profound sensorineural deafness and prolonged QT interval that can cause ventricular arrhythmias and sudden cardiac death. In contrast, Romano-Ward syndrome (RWS) typically results from dominant (heterozygous) missense variants of KCNE1 that cause prolonged QT intervals without hearing loss. The key molecular distinction is that RWS-associated mutations often produce a dominant negative effect through co-assembly of mutant KCNE1 monomers with wild-type KCNQ1 subunits. Interestingly, heterozygous carriers of loss-of-function (truncating) variants may have normal QT intervals, indicating a complex genotype-phenotype relationship. To date, only four variants of KCNE1 have been associated with JLNS2, while 44 different variants (mostly missense) are associated with RWS .

How do specific KCNE1 mutations affect cardiac electrophysiology parameters?

Different KCNE1 mutations produce distinct effects on cardiac electrophysiology parameters. For example, the A8V N-terminus mutation found in a patient with marked QT interval prolongation (QTc 600 ms) produces little alteration in IKs (KCNQ1 current) but markedly suppresses IhERG density. The D85N C-terminal polymorphism exerts a dominant negative effect to reduce IhERG and is significantly more common in patients with drug-induced LQTS. When examining homozygous truncating mutations (p.Tyr46*), affected individuals show prolonged QTc values (using both Bazett's and Fridericia's formulas) compared to normal ranges. The table below shows QT interval measurements from a family segregating the p.Tyr46* variant:

IndividualAge (Yrs)GenderKCNE1: p.Tyr46*QT (msec)HR (bpm)QTcB (msec)QTcF (msec)
IV-649Male+/−41063420417
IV-145Female+/−40078456437
V-215Female+/+360111490442
V-513Female−/−46073507491
V-4 (Rest)18Male−/−48066503495
V-4 (Exercise)18Male−/−360119507452
V-620Male+/+40080462440
V-728Female−/−43087518487

(+ is the wild type allele, - is the p.Tyr46* nonsense mutation; QTcB = Bazett's formula, QTcF = Fridericia's formula)

What is the prevalence of KCNE1 variants in different populations, and how should researchers account for this in their studies?

The prevalence of KCNE1 variants varies across populations, making it important for researchers to consider population-specific reference data. For instance, in studies of Caucasian populations, systematic screening for KCNE1 mutations has established reference frequencies for common variants. Researchers should be careful when comparing allele frequencies across studies, as some reports may contain errors such as inverted allele counts (as noted in one study regarding G38S variants). When designing case-control studies, researchers should use appropriately matched control populations and employ exact tests of allelic association to determine statistical significance. Additionally, researchers should be aware that KCNE1 variants previously considered rare may have different frequencies in unstudied populations, necessitating careful genetic characterization when working with diverse subject groups .

How can integrative structural biology approaches be used to predict KCNE1-KCNQ1 interactions?

Integrative structural biology combines multiple experimental and computational techniques to develop comprehensive structural models of KCNE1-KCNQ1 interactions. This approach involves: (1) generating structural models of KCNQ1 channels in different states through homology modeling based on available potassium channel structures like Kv1.2; (2) utilizing experimentally determined structures of KCNE1 from solution NMR; (3) incorporating structure-function and biochemically-derived structural restraints; and (4) applying computational methods like Rosetta software to integrate these diverse data types.

The Rosetta software is particularly valuable for completing structural models by "filling in" connecting loop structures that cannot be modeled based on templates due to poor resolution or sequence alignment gaps. When applying this approach, researchers should generate multiple models representing both open and closed states of the channel complex to understand state-dependent interactions. This methodology allows for the development of testable hypotheses regarding the molecular mechanisms underlying disease-associated mutations and can guide structure-based drug design efforts .

What are the current challenges in correlating KCNE1 genetic variants with clinical phenotypes?

Several challenges exist in correlating KCNE1 genetic variants with clinical phenotypes. First, the diploid genotype is often not explicitly stated in clinical reports, making it difficult to determine if a patient is heterozygous or homozygous for a variant. Second, comprehensive screening for mutations in other long QT-associated genes is frequently lacking, potentially missing compound heterozygosity or digenic inheritance patterns. Third, truncating variants do not always result in predictable phenotypes; for example, heterozygous carriers of certain truncating variants (like p.Tyr46*) may have normal QT intervals, while others reportedly cause RWS.

Additionally, the mechanism by which truncating variants affect protein function varies; premature translation termination in KCNE1's single protein-coding exon may not trigger nonsense-mediated decay (NMD) of the mutant mRNA, resulting in truncated proteins with unpredictable functional consequences. Finally, ascertainment bias affects our understanding of genotype-phenotype correlations, as most KCNE1 variants have been identified in subjects with prolonged QT intervals rather than through unbiased population screening .

How can mouse models be effectively used to study KCNE1 function and disease mechanisms?

Mouse models provide valuable tools for studying KCNE1 function and disease mechanisms. When generating knockout or knock-in mouse models, researchers should consider targeting strategies that minimize disruption of nearby regulatory elements. For studying JLNS2, homozygous knockout models are appropriate, while heterozygous models may be used to study carrier states or potential RWS phenotypes. Comprehensive phenotyping should include both auditory (auditory brainstem response testing, cochlear histology) and cardiac (electrocardiography, echocardiography, electrophysiology) assessments.

When interpreting results from mouse models, researchers should be aware of species-specific differences in cardiac electrophysiology and consider the effects of genetic background on phenotypic expression. For pharmacological studies, mouse models allow investigation of drug responses and potential therapies for KCNE1-related disorders. Additionally, mouse models can be used to study the interaction of environmental factors (like stress or exercise) with genetic variants, providing insights into factors that may precipitate arrhythmias in mutation carriers .

What statistical approaches are recommended for analyzing electrophysiological data from KCNE1 variants?

For dose-response relationships, nonlinear regression analysis using appropriate equations (Hill equation, Boltzmann function) should be applied. When analyzing action potential recordings or more complex electrophysiological parameters, time-series analysis methods may be required. Finally, researchers should report not only p-values but also effect sizes and confidence intervals to provide a complete understanding of the magnitude and reliability of observed differences. Sample sizes should be determined through power analysis to ensure sufficient statistical power while minimizing animal use .

How should researchers approach the interpretation of novel KCNE1 variants discovered in genetic screens?

When interpreting novel KCNE1 variants discovered in genetic screens, researchers should follow a systematic approach combining computational, functional, and clinical analyses. Initially, variants should be assessed using computational tools to predict potential functional impacts based on evolutionary conservation, physicochemical properties, and structural context. Following in silico analysis, functional characterization through expression studies in heterologous systems is essential to determine effects on channel properties.

For clinical interpretation, researchers should consider the American College of Medical Genetics (ACMG) guidelines for variant classification, although it should be noted that KCNE1 is not currently listed among the 59 medically actionable genes for which incidental findings should be reported. The authors of search result suggest that KCNE1 should be added to this list due to the life-threatening risks associated with certain variants. When reporting novel variants, researchers should provide comprehensive phenotype information, including both cardiac and auditory assessments, and clearly specify the zygosity of the variant .

What are the recommended clinical screening protocols for individuals with identified KCNE1 mutations?

For individuals with identified KCNE1 mutations, comprehensive screening protocols should assess both auditory and cardiac function. All individuals with bilateral, severe to profound congenital deafness of unknown etiology should undergo electrocardiogram (ECG) assessment of QT interval. Conversely, individuals identified with KCNE1 mutations through cardiac screening should receive audiological evaluation even in the absence of apparent hearing loss.

For individuals with prolonged QT intervals, preventative treatment for life-threatening arrhythmias may be indicated. Additionally, all medications prescribed to these patients should be reviewed to eliminate those with potential to prolong the QT interval. Family members of affected individuals should also undergo screening, as normal-hearing heterozygous carriers may still have prolonged QT intervals and associated arrhythmia risk. In a study of 104 Pakistani children with moderate to severe sensorineural hearing loss, detailed history and ECG screening revealed LQTS in four children (3.8%), with one normal-hearing family member also found to have LQTS, highlighting the importance of comprehensive screening .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.